Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g921.t1
Gene name
Locationscaffold_01:2441390..2444021
Strand+
Gene length (bp)2631
Transcript length (bp)2310
Coding sequence length (bp)2310
Protein length (aa) 770

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01794 Ferric_reduct Ferric reductase like transmembrane component 2.6E-24 286 403
PF08030 NAD_binding_6 Ferric reductase NAD binding domain 9.4E-08 609 748

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0003674 molecular_function No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 17 0.45

Transmembrane Domains

Domain # Start End Length
1 154 176 22
2 244 266 22
3 296 318 22
4 325 347 22
5 357 374 17
6 387 409 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g921.t1
MLLCWLVIALAQGGWANPEDERCVTAVYTAYNYISFAGILSQGKHSWESQCRNPLKVASIYAASDIYCNEQERTI
GMAQLANQCQEYGNLELLSREAVAENLTDDAIRNMRIVDYQELSRGEPVNAPVLLSASYFNLMFKTIESWELVTW
SHHAFGYIGYAYWGGILSLGMAYRLSDWLFHRRQRRVERVLESNVYPLMRSLDDMPLVGTGLHWIQTHLMIPPPL
AASHGRYLLGFTFSTRVEALIVVGFWTLSIVLSVVGYHTFPGNIYWPDVTSQVLRYSADRTGIMSFANLPLLWLF
AGRNNIFLWATGWSFASFNIFHRHVARVATIQAVVHSVLYIVMFHQTGKAARGMSKTYVLWGILGTFVMILLLIT
SLDRIRIATYELFLIAHVVLSILTLVACFYHTIIFEGNEYWKYLWPTVALWVVDRFLRIVRLCYCNLHVSLSNRL
VKVSESHMVYDETADVVRLEVILGTPSLQPSPGQYYFLYQPFRLTGWESHPFTVGAWSYEIGDQTSLAPKNEGKS
TRSLDVSHVPLLAGGPSDQDYPESSENMSKQEKLSKLNLTFWVRPYDGWTRHLRQQCLSSPAKTSKTTILLEGPY
GETFPLWRYESVLIIVGGTGIASAVPYIQDHLRRSVEDWDESPEMEKTRVRDMELVWTTKQAAFIRDVSRRELKR
ALKREDFSASFYATRDSTASSEDPTDFGFDIQSGRPHLQSLIMSRACDASSAGSSLAILVCGPPRMADEARAATH
LAMRQGHRSIKFVEESFTW*
Coding >Pro_DTO377G3_2|g921.t1
ATGTTGCTCTGTTGGCTGGTAATCGCACTCGCCCAAGGTGGCTGGGCTAATCCAGAGGATGAGCGGTGTGTGACG
GCGGTCTACACGGCATACAACTACATATCATTTGCTGGCATTCTCTCACAAGGCAAGCACAGCTGGGAATCGCAA
TGCCGGAATCCGCTCAAGGTCGCATCGATATACGCCGCATCCGATATATATTGCAATGAGCAGGAACGGACGATA
GGCATGGCGCAGCTGGCTAACCAGTGCCAAGAATATGGGAACCTAGAGCTGCTGTCGAGGGAAGCGGTCGCCGAA
AACCTGACAGACGATGCTATAAGGAATATGAGAATTGTCGACTATCAAGAGCTGTCCCGAGGCGAACCAGTGAAT
GCGCCTGTCCTTCTTTCTGCGTCTTACTTCAACCTAATGTTCAAAACGATTGAATCTTGGGAACTTGTGACTTGG
TCACATCATGCATTTGGTTATATTGGCTACGCCTATTGGGGTGGTATACTATCTTTGGGGATGGCCTATCGCTTG
AGTGATTGGCTATTCCATCGCCGACAACGCCGTGTAGAGCGTGTACTCGAATCCAATGTATATCCCCTCATGAGG
TCCTTGGACGATATGCCGTTGGTGGGCACCGGTCTTCACTGGATCCAGACTCATCTGATGATCCCACCGCCTTTG
GCAGCATCACATGGTCGATACCTGCTAGGCTTCACATTCTCCACCAGAGTCGAGGCGCTTATAGTCGTGGGATTC
TGGACGCTCAGCATCGTATTGAGTGTCGTGGGCTATCACACCTTTCCCGGAAATATTTACTGGCCCGATGTCACA
AGCCAGGTTCTTCGTTATTCTGCAGACCGCACTGGGATCATGTCATTTGCGAATTTGCCCCTTCTATGGCTCTTT
GCCGGACGAAATAATATTTTTCTTTGGGCCACCGGGTGGAGCTTTGCATCGTTCAATATATTCCATCGCCATGTG
GCCCGGGTGGCTACTATACAGGCAGTAGTGCACTCTGTCCTTTACATTGTCATGTTCCATCAAACGGGCAAAGCT
GCGAGGGGTATGTCGAAGACCTATGTTTTGTGGGGTATTTTGGGCACATTCGTGATGATTCTGCTGTTGATCACC
TCATTGGATCGGATCCGAATTGCGACATATGAGCTCTTCTTGATTGCTCATGTCGTACTTTCGATTCTCACCCTT
GTCGCGTGCTTTTACCATACCATTATATTTGAAGGAAACGAATACTGGAAGTACCTGTGGCCCACGGTAGCTTTA
TGGGTCGTTGATCGATTCCTTCGAATTGTGAGGTTGTGTTACTGTAACCTTCACGTGAGTCTCTCAAACAGACTT
GTGAAAGTTTCTGAGAGCCATATGGTTTACGACGAAACGGCCGACGTGGTGCGATTGGAGGTCATACTAGGAACG
CCTTCACTGCAGCCTTCACCAGGGCAGTACTACTTCCTATACCAGCCATTTAGGCTTACCGGCTGGGAGAGCCAT
CCTTTTACCGTTGGAGCATGGTCTTACGAAATAGGGGACCAGACATCATTGGCGCCAAAAAACGAGGGAAAATCA
ACTAGATCGCTTGATGTTTCGCATGTGCCGCTTCTTGCAGGCGGTCCCTCCGATCAAGATTATCCAGAAAGCTCA
GAAAACATGTCGAAGCAGGAGAAATTGTCGAAGTTGAACTTGACTTTCTGGGTCCGCCCGTATGACGGTTGGACC
AGACACTTGCGCCAGCAATGTCTGAGCTCACCAGCCAAGACTAGCAAAACGACCATTCTTCTTGAAGGCCCATAC
GGAGAAACCTTTCCCCTGTGGAGGTATGAATCAGTCTTGATTATCGTCGGTGGGACAGGAATAGCGTCGGCTGTG
CCTTATATTCAAGATCATCTCCGCCGGTCTGTTGAAGACTGGGACGAAAGCCCCGAAATGGAGAAGACACGAGTG
CGAGACATGGAGCTTGTTTGGACCACCAAACAAGCGGCGTTCATAAGAGATGTCTCTCGCCGGGAACTGAAACGT
GCCCTCAAACGAGAGGACTTCAGCGCCTCTTTTTATGCTACGCGTGATTCCACCGCATCCTCTGAAGATCCTACC
GATTTTGGATTCGATATCCAGTCAGGTCGACCCCACCTTCAATCCCTGATCATGAGCAGGGCCTGCGATGCATCC
TCGGCTGGAAGTAGCCTTGCGATCCTCGTATGTGGCCCACCCAGAATGGCGGATGAAGCGCGCGCCGCGACACAT
CTTGCGATGCGACAGGGCCACCGCTCGATCAAATTTGTGGAGGAGTCTTTTACGTGGTAG
Transcript >Pro_DTO377G3_2|g921.t1
ATGTTGCTCTGTTGGCTGGTAATCGCACTCGCCCAAGGTGGCTGGGCTAATCCAGAGGATGAGCGGTGTGTGACG
GCGGTCTACACGGCATACAACTACATATCATTTGCTGGCATTCTCTCACAAGGCAAGCACAGCTGGGAATCGCAA
TGCCGGAATCCGCTCAAGGTCGCATCGATATACGCCGCATCCGATATATATTGCAATGAGCAGGAACGGACGATA
GGCATGGCGCAGCTGGCTAACCAGTGCCAAGAATATGGGAACCTAGAGCTGCTGTCGAGGGAAGCGGTCGCCGAA
AACCTGACAGACGATGCTATAAGGAATATGAGAATTGTCGACTATCAAGAGCTGTCCCGAGGCGAACCAGTGAAT
GCGCCTGTCCTTCTTTCTGCGTCTTACTTCAACCTAATGTTCAAAACGATTGAATCTTGGGAACTTGTGACTTGG
TCACATCATGCATTTGGTTATATTGGCTACGCCTATTGGGGTGGTATACTATCTTTGGGGATGGCCTATCGCTTG
AGTGATTGGCTATTCCATCGCCGACAACGCCGTGTAGAGCGTGTACTCGAATCCAATGTATATCCCCTCATGAGG
TCCTTGGACGATATGCCGTTGGTGGGCACCGGTCTTCACTGGATCCAGACTCATCTGATGATCCCACCGCCTTTG
GCAGCATCACATGGTCGATACCTGCTAGGCTTCACATTCTCCACCAGAGTCGAGGCGCTTATAGTCGTGGGATTC
TGGACGCTCAGCATCGTATTGAGTGTCGTGGGCTATCACACCTTTCCCGGAAATATTTACTGGCCCGATGTCACA
AGCCAGGTTCTTCGTTATTCTGCAGACCGCACTGGGATCATGTCATTTGCGAATTTGCCCCTTCTATGGCTCTTT
GCCGGACGAAATAATATTTTTCTTTGGGCCACCGGGTGGAGCTTTGCATCGTTCAATATATTCCATCGCCATGTG
GCCCGGGTGGCTACTATACAGGCAGTAGTGCACTCTGTCCTTTACATTGTCATGTTCCATCAAACGGGCAAAGCT
GCGAGGGGTATGTCGAAGACCTATGTTTTGTGGGGTATTTTGGGCACATTCGTGATGATTCTGCTGTTGATCACC
TCATTGGATCGGATCCGAATTGCGACATATGAGCTCTTCTTGATTGCTCATGTCGTACTTTCGATTCTCACCCTT
GTCGCGTGCTTTTACCATACCATTATATTTGAAGGAAACGAATACTGGAAGTACCTGTGGCCCACGGTAGCTTTA
TGGGTCGTTGATCGATTCCTTCGAATTGTGAGGTTGTGTTACTGTAACCTTCACGTGAGTCTCTCAAACAGACTT
GTGAAAGTTTCTGAGAGCCATATGGTTTACGACGAAACGGCCGACGTGGTGCGATTGGAGGTCATACTAGGAACG
CCTTCACTGCAGCCTTCACCAGGGCAGTACTACTTCCTATACCAGCCATTTAGGCTTACCGGCTGGGAGAGCCAT
CCTTTTACCGTTGGAGCATGGTCTTACGAAATAGGGGACCAGACATCATTGGCGCCAAAAAACGAGGGAAAATCA
ACTAGATCGCTTGATGTTTCGCATGTGCCGCTTCTTGCAGGCGGTCCCTCCGATCAAGATTATCCAGAAAGCTCA
GAAAACATGTCGAAGCAGGAGAAATTGTCGAAGTTGAACTTGACTTTCTGGGTCCGCCCGTATGACGGTTGGACC
AGACACTTGCGCCAGCAATGTCTGAGCTCACCAGCCAAGACTAGCAAAACGACCATTCTTCTTGAAGGCCCATAC
GGAGAAACCTTTCCCCTGTGGAGGTATGAATCAGTCTTGATTATCGTCGGTGGGACAGGAATAGCGTCGGCTGTG
CCTTATATTCAAGATCATCTCCGCCGGTCTGTTGAAGACTGGGACGAAAGCCCCGAAATGGAGAAGACACGAGTG
CGAGACATGGAGCTTGTTTGGACCACCAAACAAGCGGCGTTCATAAGAGATGTCTCTCGCCGGGAACTGAAACGT
GCCCTCAAACGAGAGGACTTCAGCGCCTCTTTTTATGCTACGCGTGATTCCACCGCATCCTCTGAAGATCCTACC
GATTTTGGATTCGATATCCAGTCAGGTCGACCCCACCTTCAATCCCTGATCATGAGCAGGGCCTGCGATGCATCC
TCGGCTGGAAGTAGCCTTGCGATCCTCGTATGTGGCCCACCCAGAATGGCGGATGAAGCGCGCGCCGCGACACAT
CTTGCGATGCGACAGGGCCACCGCTCGATCAAATTTGTGGAGGAGTCTTTTACGTGGTAG
Gene >Pro_DTO377G3_2|g921.t1
ATGTTGCTCTGTTGGCTGGTAATCGCACTCGCCCAAGGTGGCTGGGCTAATCCAGAGGATGAGCGGTGTGTGACG
GCGGTCTACACGGCATACAACTACATATCATTTGCTGGCATTCTCTCACAAGGCAAGCACAGCTGGGAATCGCAA
TGCCGGAATCCGCTCAAGGTCGCATCGATATACGCCGCATCCGATATATATTGCAATGAGCAGGAACGGACGATA
GGCATGGCGCAGCTGGCTAACCAGTGCCAAGAATATGGGAACCTAGAGCTGCTGTCGAGGGAAGCGGTCGCCGAA
AACCTGACAGACGATGCTATAAGGAATATGAGAATTGTCGACTATCAAGAGCTGTCCCGAGGCGAACCAGTGAAT
GCGCCTGTCCTTCTTTCTGCGTCTTACTTCAACCTAATGTTCAAAACGATTGTGAGACCTTCTGGACCTTGAATA
TGCTAGTCCTAAAGCTTATTGATGTCCTAGGAATCTTGGGAACTTGTGACTTGGTCACATCATGCATTTGGGTAA
GTCTGCTCAAGCTGGCAAGCAAGACATATATTGACTAATCAGTTATATTGGCTACGCCTATTGGGGTGGTATACT
ATCTTTGGGGATGGCCTATCGCTTGAGTGATTGGCTATTCCATCGCCGACAACGCCGTGTAGAGCGTGTACTCGA
ATCCAATGTATATCCCCTCATGAGGTCCTTGGACGATATGCCGTTGGTGGGCACCGGTCTTCACTGGATCCAGAC
TCATCTGATGATCCCACCGCCTTTGGCAGCATCACATGGTCGATACCTGCTAGGCTTCACATTCTCCACCAGAGT
CGAGGCGCTTATAGTCGTGGGATTCTGGACGCTCAGCATCGTATTGAGTGTCGTGGGCTATCACACCTTTCCCGG
AAATATTTAGTAGGTACCAGCCTGTGGAAGCGAGATGTGCAATGTTGACAGGTAGTCTAGCTGGCCCGATGTCAC
AAGCCAGGTTCTTCGTTATTCTGCAGACCGCACTGGGATCATGTCATTTGCGAATTTGCCCCTTCTATGGCTCTT
TGCCGGACGAAATAATATTTTTCTTTGGGCCACCGGGTGGAGCTTTGCATCGTTCAATATATTCCATCGCCATGT
GGCCCGGGTGGCTACTATACAGGCAGTAGTGCACTCTGTCCTTTACATTGTCATGTTCCATCAAAGTAAGTATTG
CTCGTTTGGCTTTCAATGCGCGCTAGGATACTTACAGTCATTCCGACAGCGGGCAAAGCTGCGAGGGGTATGTCG
AAGACCTATGTTTTGTGGGGTATTTTGGTAGGCCCCCCAATTTAATTGATCCCAAGTTGGTCGATCTCTAATTCA
TGTTGTATTAGGGCACATTCGTGATGATTCTGCTGTTGATCACCTCATTGGATCGGATCCGAATTGCGACATATG
AGCTCTTCTTGATTGCTCATGTCGTACTTTCGATTCTCACCCTTGTCGCGTGCTTTTAGTAAGTACATCCCCGCG
ATGAAATTTCTGCATCTATTTCTAACAATTGGCAGCCATACCATTATATTTGAAGGAAACGAATACTGGAAGTAC
CTGTGGCCCACGGTAGCTTTATGGGTCGTTGATCGATTCCTTCGAATTGTGAGGTTGTGTTACTGTAACCTTCAC
GTGAGTCTCTCAAACAGACTTGTGAAAGTTTCTGAGAGCCATATGGTTTACGACGAAACGGCCGACGTGGTGCGA
TTGGAGGTCATACTAGGAACGCCTTCACTGCAGCCTTCACCAGGGCAGTACTACTTCCTATACCAGCCATTTAGG
CTTACCGGCTGGGAGAGCCATCCTTTTACCGTTGGAGCATGGTCTTACGAAATAGGGGACCAGACATCATTGGCG
CCAAAAAACGAGGGAAAATCAACTAGATCGCTTGATGTTTCGCATGTGCCGCTTCTTGCAGGCGGTCCCTCCGAT
CAAGATTATCCAGAAAGCTCAGAAAACATGTCGAAGCAGGAGAAATTGTCGAAGTTGAACTTGACTTTCTGGGTC
CGCCCGTATGACGGTTGGACCAGACACTTGCGCCAGCAATGTCTGAGCTCACCAGCCAAGACTAGCAAAACGACC
ATTCTTCTTGAAGGCCCATACGGAGAAACCTTTCCCCTGTGGAGGTATGAATCAGTCTTGATTATCGTCGGTGGG
ACAGGAATAGCGTCGGCTGTGCCTTATATTCAAGATCATCTCCGCCGGTCTGTTGAAGACTGGGACGAAAGCCCC
GAAATGGAGAAGACACGAGTGCGAGACATGGAGCTTGTTTGGACCACCAAACAAGCGGCGTTCATAAGAGATGTC
TCTCGCCGGGAACTGAAACGTGCCCTCAAACGAGAGGACTTCAGCGCCTCTTTTTATGCTACGCGTGATTCCACC
GCATCCTCTGAAGATCCTACCGATTTTGGATTCGATATCCAGTCAGGTCGACCCCACCTTCAATCCCTGATCATG
AGCAGGGCCTGCGATGCATCCTCGGCTGGAAGTAGCCTTGCGATCCTCGTATGTGGCCCACCCAGAATGGCGGAT
GAAGCGCGCGCCGCGACACATCTTGCGATGCGACAGGGCCACCGCTCGATCAAATTTGTGGAGGAGTCTTTTACG
TGGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail