Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g919.t1
Gene name
Locationscaffold_01:2434727..2437503
Strand-
Gene length (bp)2776
Transcript length (bp)2280
Coding sequence length (bp)2280
Protein length (aa) 760

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03169 OPT OPT oligopeptide transporter protein 8.2E-157 56 719

GO

GO Term Description Terminal node
GO:0055085 transmembrane transport Yes
GO:0008150 biological_process No
GO:0051234 establishment of localization No
GO:0006810 transport No
GO:0051179 localization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 40 0.45

Transmembrane Domains

Domain # Start End Length
1 55 77 22
2 163 185 22
3 195 214 19
4 230 247 17
5 304 326 22
6 380 402 22
7 440 462 22
8 469 491 22
9 552 574 22
10 618 640 22
11 664 686 22
12 699 721 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g919.t1
MEANKDTDINLLERNIREKEEVQDENNTDSDIDSQTEILRAAGIGIAKDDPTEPVLTLRMWVIGIAFCVIVSGLN
TLYTLRAPSLTISGSVVLLLAYPLGKLWEKIVPNWTVPLGRLAFELNPGPFNTKEHVLIFIMSNLSIYVRLGADV
LTEQQMFYGYKAGWGFQILITFSTFLIGFCLAGLFRAIVVVPQELIWPGVLGVTALTTTLHHVNQQKVQVTYNTW
KMSRYAFFGMAFSISFCWYWFPDFIFPALSYFSFPCWIKPESKVVNQIFGMNSGMGLLPLTFDWSQISYVGSPLL
IPSWAVFNVFVSLVFWIWIVAVALYYSNVWNTGYLPFQSSQVFDNTGNIYKVKKIVNAASGYKLDVKKYLAYSPV
YMPVTYALNMFGLSFATLSALLVWVVLEKRHVMADAAKRVPRLVLESFPGRSREYSEDERGDPDVPLWWYLVACV
LALFMSMFAVEWWNVELRWYGVLLACTVALIFYPALALVYATSNLKINIDIFCRIVAGFVFEGKVLANIWFFDIG
YITTIKGLYFAQDMKLAYYCHIPQRKLFLVQCVGMVIGTLSSLGVLNWALNHITGVCTSAAVNGFTCPYSRTHFN
TSLIWGAVGPRRYFSNQIGYSALLYFFIVGAILPIPVYYMTRRYPKSLWRRVHIPLFLGGLNYLPPATGMNYGSW
AVVGLTFGWLIRKRLHSWWSKYNFVLSSAMDSSVGIAGVLIFLTIFFTGASNHFKWWGTEVYKNTCDWKGCPDLS
VPKGHKFGV*
Coding >Pro_DTO377G3_2|g919.t1
ATGGAAGCCAACAAGGACACAGATATTAACCTGCTGGAGAGAAACATTCGGGAAAAGGAAGAAGTTCAGGATGAA
AATAATACCGATTCCGACATAGATTCACAGACCGAAATCTTGCGGGCTGCTGGTATAGGTATAGCTAAAGATGAT
CCTACTGAGCCCGTCCTCACTCTACGTATGTGGGTGATAGGAATTGCCTTTTGTGTCATCGTTAGCGGGTTGAAC
ACACTCTACACGCTCCGTGCACCTTCCTTGACAATTTCCGGCTCGGTTGTCCTCTTGTTGGCTTATCCCCTGGGA
AAGCTTTGGGAGAAAATCGTCCCGAACTGGACCGTTCCTCTAGGACGACTGGCATTTGAGCTCAACCCGGGTCCT
TTTAATACAAAGGAACATGTCTTGATCTTTATTATGTCCAACCTCAGTATCTACGTTCGTCTTGGCGCCGATGTC
CTGACAGAGCAGCAAATGTTCTACGGTTACAAAGCAGGATGGGGATTCCAAATTCTCATTACTTTCTCCACATTC
CTCATCGGGTTCTGTCTTGCTGGTCTATTCCGGGCGATTGTGGTCGTTCCCCAAGAGCTGATCTGGCCTGGGGTG
CTGGGTGTTACTGCGTTGACCACAACGCTGCATCATGTCAACCAGCAAAAAGTGCAAGTGACTTACAATACTTGG
AAAATGTCCCGCTATGCCTTCTTCGGTATGGCATTTTCCATCTCGTTCTGCTGGTATTGGTTCCCAGACTTCATC
TTCCCGGCGCTTAGCTATTTCAGCTTCCCGTGTTGGATCAAGCCTGAGAGCAAAGTAGTCAATCAGATCTTCGGA
ATGAATTCTGGAATGGGGCTGTTGCCGCTTACATTTGATTGGAGCCAAATATCTTACGTCGGATCACCCTTGCTC
ATCCCATCGTGGGCAGTTTTCAACGTCTTCGTTTCCCTGGTGTTCTGGATTTGGATTGTGGCTGTTGCTCTATAC
TATTCCAATGTGTGGAACACAGGCTACCTGCCTTTCCAAAGCTCTCAAGTATTCGACAATACCGGGAATATTTAT
AAAGTCAAAAAGATTGTCAATGCAGCCTCAGGCTACAAGCTCGATGTTAAGAAGTACCTTGCTTATTCCCCGGTC
TATATGCCAGTGACCTACGCGTTGAACATGTTTGGGCTCTCATTTGCGACCCTGAGCGCTCTTCTTGTTTGGGTT
GTCCTTGAAAAGCGTCATGTCATGGCCGATGCTGCCAAAAGGGTGCCTCGGCTAGTCCTGGAGTCTTTTCCCGGT
CGCTCTAGAGAGTACAGCGAGGACGAGCGGGGAGACCCAGATGTGCCTTTGTGGTGGTACCTGGTTGCATGCGTC
TTAGCCTTATTCATGTCGATGTTCGCCGTTGAGTGGTGGAACGTTGAACTGAGATGGTACGGTGTTCTGCTGGCG
TGTACTGTGGCACTGATATTTTATCCTGCGTTGGCCCTGGTCTATGCCACTTCTAACCTCAAGATCAATATCGAC
ATCTTCTGCCGTATCGTGGCCGGTTTCGTCTTTGAGGGCAAAGTCCTGGCCAATATCTGGTTCTTTGACATCGGA
TACATCACAACCATCAAGGGTCTTTACTTTGCCCAGGATATGAAACTCGCTTACTATTGCCATATCCCGCAACGA
AAACTGTTCTTGGTTCAATGCGTGGGAATGGTTATCGGCACGCTCTCCTCGCTCGGTGTCCTCAATTGGGCCCTG
AATCATATCACCGGCGTCTGCACTAGCGCTGCTGTTAACGGTTTCACTTGTCCTTACAGCAGAACCCACTTCAAT
ACTTCCTTGATCTGGGGTGCAGTGGGTCCTCGTCGTTACTTCTCAAACCAAATTGGCTATTCCGCTTTGCTTTAT
TTCTTCATCGTCGGTGCCATTCTACCCATTCCCGTCTATTATATGACCCGCCGATACCCCAAGTCACTGTGGAGA
AGGGTTCATATTCCCCTGTTCCTCGGTGGGCTCAATTACTTGCCCCCTGCGACCGGAATGAATTACGGAAGCTGG
GCAGTTGTTGGACTCACCTTTGGCTGGCTCATTCGGAAGCGTCTGCATAGCTGGTGGAGTAAGTATAACTTTGTG
CTGAGTTCTGCCATGGACTCGTCAGTGGGAATTGCTGGTGTCTTGATTTTCTTGACAATTTTCTTTACTGGAGCC
AGCAACCATTTCAAATGGTGGGGAACAGAGGTTTACAAGAACACCTGCGACTGGAAAGGTTGTCCCGATCTTTCT
GTACCAAAGGGCCATAAGTTCGGCGTGTAG
Transcript >Pro_DTO377G3_2|g919.t1
ATGGAAGCCAACAAGGACACAGATATTAACCTGCTGGAGAGAAACATTCGGGAAAAGGAAGAAGTTCAGGATGAA
AATAATACCGATTCCGACATAGATTCACAGACCGAAATCTTGCGGGCTGCTGGTATAGGTATAGCTAAAGATGAT
CCTACTGAGCCCGTCCTCACTCTACGTATGTGGGTGATAGGAATTGCCTTTTGTGTCATCGTTAGCGGGTTGAAC
ACACTCTACACGCTCCGTGCACCTTCCTTGACAATTTCCGGCTCGGTTGTCCTCTTGTTGGCTTATCCCCTGGGA
AAGCTTTGGGAGAAAATCGTCCCGAACTGGACCGTTCCTCTAGGACGACTGGCATTTGAGCTCAACCCGGGTCCT
TTTAATACAAAGGAACATGTCTTGATCTTTATTATGTCCAACCTCAGTATCTACGTTCGTCTTGGCGCCGATGTC
CTGACAGAGCAGCAAATGTTCTACGGTTACAAAGCAGGATGGGGATTCCAAATTCTCATTACTTTCTCCACATTC
CTCATCGGGTTCTGTCTTGCTGGTCTATTCCGGGCGATTGTGGTCGTTCCCCAAGAGCTGATCTGGCCTGGGGTG
CTGGGTGTTACTGCGTTGACCACAACGCTGCATCATGTCAACCAGCAAAAAGTGCAAGTGACTTACAATACTTGG
AAAATGTCCCGCTATGCCTTCTTCGGTATGGCATTTTCCATCTCGTTCTGCTGGTATTGGTTCCCAGACTTCATC
TTCCCGGCGCTTAGCTATTTCAGCTTCCCGTGTTGGATCAAGCCTGAGAGCAAAGTAGTCAATCAGATCTTCGGA
ATGAATTCTGGAATGGGGCTGTTGCCGCTTACATTTGATTGGAGCCAAATATCTTACGTCGGATCACCCTTGCTC
ATCCCATCGTGGGCAGTTTTCAACGTCTTCGTTTCCCTGGTGTTCTGGATTTGGATTGTGGCTGTTGCTCTATAC
TATTCCAATGTGTGGAACACAGGCTACCTGCCTTTCCAAAGCTCTCAAGTATTCGACAATACCGGGAATATTTAT
AAAGTCAAAAAGATTGTCAATGCAGCCTCAGGCTACAAGCTCGATGTTAAGAAGTACCTTGCTTATTCCCCGGTC
TATATGCCAGTGACCTACGCGTTGAACATGTTTGGGCTCTCATTTGCGACCCTGAGCGCTCTTCTTGTTTGGGTT
GTCCTTGAAAAGCGTCATGTCATGGCCGATGCTGCCAAAAGGGTGCCTCGGCTAGTCCTGGAGTCTTTTCCCGGT
CGCTCTAGAGAGTACAGCGAGGACGAGCGGGGAGACCCAGATGTGCCTTTGTGGTGGTACCTGGTTGCATGCGTC
TTAGCCTTATTCATGTCGATGTTCGCCGTTGAGTGGTGGAACGTTGAACTGAGATGGTACGGTGTTCTGCTGGCG
TGTACTGTGGCACTGATATTTTATCCTGCGTTGGCCCTGGTCTATGCCACTTCTAACCTCAAGATCAATATCGAC
ATCTTCTGCCGTATCGTGGCCGGTTTCGTCTTTGAGGGCAAAGTCCTGGCCAATATCTGGTTCTTTGACATCGGA
TACATCACAACCATCAAGGGTCTTTACTTTGCCCAGGATATGAAACTCGCTTACTATTGCCATATCCCGCAACGA
AAACTGTTCTTGGTTCAATGCGTGGGAATGGTTATCGGCACGCTCTCCTCGCTCGGTGTCCTCAATTGGGCCCTG
AATCATATCACCGGCGTCTGCACTAGCGCTGCTGTTAACGGTTTCACTTGTCCTTACAGCAGAACCCACTTCAAT
ACTTCCTTGATCTGGGGTGCAGTGGGTCCTCGTCGTTACTTCTCAAACCAAATTGGCTATTCCGCTTTGCTTTAT
TTCTTCATCGTCGGTGCCATTCTACCCATTCCCGTCTATTATATGACCCGCCGATACCCCAAGTCACTGTGGAGA
AGGGTTCATATTCCCCTGTTCCTCGGTGGGCTCAATTACTTGCCCCCTGCGACCGGAATGAATTACGGAAGCTGG
GCAGTTGTTGGACTCACCTTTGGCTGGCTCATTCGGAAGCGTCTGCATAGCTGGTGGAGTAAGTATAACTTTGTG
CTGAGTTCTGCCATGGACTCGTCAGTGGGAATTGCTGGTGTCTTGATTTTCTTGACAATTTTCTTTACTGGAGCC
AGCAACCATTTCAAATGGTGGGGAACAGAGGTTTACAAGAACACCTGCGACTGGAAAGGTTGTCCCGATCTTTCT
GTACCAAAGGGCCATAAGTTCGGCGTGTAG
Gene >Pro_DTO377G3_2|g919.t1
ATGGAAGCCAACAAGGACACAGATATTAACCTGCTGGAGAGAAACATTCGGGAAAAGGAAGAAGTTCAGGATGAA
AATAATACCGATTCCGGTAAGTCTGCTGCTGCCTGTTGCTGTGGCTTGGGGTTTTTTTCCTTCTTTTTTTGCGAG
ATTCTCACACCACTGCAGACATAGATTCACAGACCGAAATCTTGCGGGCTGCTGGTATAGGTATAGCTAAAGATG
ATCCTACTGAGCCCGTCCTCACTCTACGTATGTGGGTGATAGGAATTGCCTTTTGTGTCATCGTTAGCGGGTTGA
ACACACTCTACACGCTCCGTGCACCTTCCTTGACAATTTCCGGCTCGGTTGTCCTCTTGTTGGCTTATCCCCTGG
GAAAGCTTTGGGAGAAAATCGTCCCGAACTGGACCGTTCCTCTAGGACGACTGGCATTTGAGCTCAACCCGGGTC
CTTTTAATACAAAGGTATGTTCCCTGGCAACGTCACAGTAATCAGTTTAACAAAGGTTATTCTAGGAACATGTCT
TGATCTTTATTATGTCCAACCTCAGTATCTACGTTCGTCTTGGCGCCGATGTCCTGACAGAGCAGCAAATGTTCT
ACGGTTACAAAGCAGGATGGGGATTCCAAATTCTCATTACTTTCTCCACATTCCTCATCGGGTTCTGTCTTGCTG
GTCTATTCCGGGCGATTGTGGTCGTTCCCCAAGAGCTGATCTGGCCTGGGGTGCTGGGTGTTACTGCGTTGACCA
CAACGCTGCATCATGTCAACCAGCAAAAAGTGCAAGTGACGTAAGTTCCCTGTATTTATTTGTTGTCTCGGTGAA
TGGAACTGATAGATGGTAGTTACAATACTTGGAAAATGTCCCGCTATGCCTTCTTCGGTATGGCATTTTCCATCT
CGTTCTGCTGGTATTGGTTCCCAGACTTCATCTTCCCGGCGCTTAGCTATTTCAGCTTCCCGTGTTGGATCAAGC
CTGAGAGCAAAGTAGTCAATCAGATCTTCGGAATGAATTCTGGAATGGGGCTGTTGCCGCTTACATTTGATTGTG
AGTATCACAACCTTTCAGGTCAATTACCGTGCTGACCCCAATAGGGAGCCAAATATCTTACGTCGGATCACCCTT
GCTCATCCCATCGTGGGCAGTTTTCAACGTCTTCGTTTCCCTGGTGTTCTGGATTTGGATTGTGGCTGTTGCTCT
ATACTATTCCAATGTGTGGAACACAGGCTACCTGCCTTTCCAAAGCTCTCAAGGTACAACCCATCCTTTCAAGCT
CCCGACCAAATCTAACTTGTGCAAACAGTATTCGACAATACCGGGAATATTTATAAAGTCAAAAAGATTGTCAAT
GCAGCCTCAGGCTACAAGCTCGATGTTAAGAAGTACCTTGCTTATTCCCCGGTATGTTTACACGTTCTATAAACT
CAAAAAACTTGACATTCTGCTAACTTGTGGAACGTTTAGGTCTATATGCCAGTGACCTACGCGTTGAACATGTTT
GGGCTCTCATTTGCGACCCTGAGCGCTCTTCTTGTTTGGGTTGTCCTTGAAAAGCGTCATGTCATGGCCGATGCT
GCCAAAAGGGTGCCTCGGCTAGTCCTGGAGTCTTTTCCCGGTCGCTCTAGAGAGTACAGCGAGGACGAGCGGGGA
GACCCAGATGTGCCTTTGTGGTGGTACCTGGTTGCATGCGTCTTAGCCTTATTCATGTCGATGTTCGCCGTTGAG
TGGTGGAACGTTGAACTGAGATGGTACGGTGTTCTGCTGGCGTGTACTGTGGCACTGATATTTTATCCTGCGGTG
AGTCTACCTGAAGTTCCGATTTACACATTGGACACCTCTCTGACCAATCTTAGTTGGCCCTGGTCTATGCCACTT
CTAACCTCAAGATCAATATCGACATCTTCTGCCGTATCGTGGCCGGTTTCGTCTTTGAGGGCAAAGTCCTGGCCA
ATATCTGGTTCTTTGACATCGGATACATCACAACCATCAAGGGTCTTTACTTTGCCCAGGATATGAAACTCGCTT
ACTATTGCCATGCAAGCCCTTTCCTTCCTACTATAGTTGAATCATGCTAATACCCGGAAGATCCCGCAACGAAAA
CTGTTCTTGGTTCAATGCGTGGGAATGGTTATCGGCACGCTCTCCTCGCTCGGTGTCCTCAATTGGGCCCTGAAT
CATATCACCGGCGTCTGCACTAGCGCTGCTGTTAACGGTTTCACTTGTCCTTACAGCAGAACCCACTTCAATACT
TCCTTGATCTGGGGTGCAGTGGGTCCTCGTCGTTACTTCTCAAACCAAATTGGCTATTCCGCTTTGCTTTATTTC
TTCATCGTCGGTGCCATTCTACCCATTCCCGTCTATTATATGACCCGCCGATACCCCAAGTCACTGTGGAGAAGG
GTTCATATTCCCCTGTTCCTCGGTGGGCTCAATTACTTGCCCCCTGCGACCGGAATGAATTACGGAAGCTGGGCA
GTTGTTGGACTCACCTTTGGCTGGCTCATTCGGAAGCGTCTGCATAGCTGGTGGAGTAAGTATAACTTTGTGCTG
AGTTCTGCCATGGACTCGTCAGTGGGAATTGCTGGTGTCTTGATTTTCTTGACAATTTTCTTTACTGGAGCCAGC
AACCATTTCAAATGGTGGGGAACAGAGGTTTACAAGGTGTGTTTACCCCCTCTGACGTTCAATTACTTATACTAA
CTATTAGCAGAACACCTGCGACTGGAAAGGTTGTCCCGATCTTTCTGTACCAAAGGGCCATAAGTTCGGCGTGTA
G

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail