Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g9188.t1
Gene name
Locationscaffold_43:49198..49781
Strand+
Gene length (bp)583
Transcript length (bp)477
Coding sequence length (bp)477
Protein length (aa) 159

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00293 NUDIX NUDIX domain 8.4E-18 24 142

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 64 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 129.99 71.55 188.43
5d_25C Five days - 25 degrees Celsius 132.45 73.12 191.78
7d_25C Seven days - 25 degrees Celsius 125.74 68.47 183.01
10d_25C Ten days - 25 degrees Celsius 116.78 62.88 170.69
7d_15C Seven days - 15 degrees Celsius 157.68 89.61 225.75
7d_30C Seven days - 30 degrees Celsius 125.49 68.04 182.94

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.963619 no
3d_25C 7d_25C 0.933801 no
3d_25C 7d_15C 0.501654 no
3d_25C 7d_30C 0.927697 no
3d_25C 10d_25C 0.754803 no
5d_25C 7d_25C 0.890576 no
5d_25C 7d_15C 0.552537 no
5d_25C 7d_30C 0.883314 no
5d_25C 10d_25C 0.705470 no
7d_25C 7d_15C 0.411044 no
7d_25C 7d_30C 0.996331 no
7d_25C 10d_25C 0.837375 no
7d_15C 7d_30C 0.403010 no
7d_15C 10d_25C 0.252055 no
7d_30C 10d_25C 0.844052 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g9188.t1
MAQIRSMEARVGRKNQRYGSKGERLVAGVVPISADKTKVLMIQSAGPGGWVLPKGGWELDEKTAEQAACREAWEE
AGVICVVTRDLGLIPDMRPSGLLTAHAPKASYQFFEVTVQQEETEWPEMHKRKRQWVSYTQAATALANRPELLEA
LHRSSLKR*
Coding >Pro_DTO377G3_2|g9188.t1
ATGGCTCAAATACGGTCTATGGAAGCCCGCGTTGGGCGGAAAAACCAACGCTACGGCTCAAAAGGCGAGCGACTG
GTAGCCGGCGTTGTCCCTATTTCCGCCGACAAGACCAAAGTCCTCATGATTCAATCCGCAGGACCCGGAGGCTGG
GTGCTCCCCAAGGGCGGTTGGGAGCTCGATGAGAAAACTGCCGAGCAGGCTGCATGCCGTGAGGCCTGGGAGGAA
GCGGGTGTCATCTGTGTCGTGACCAGAGATCTGGGACTCATTCCGGACATGAGACCCTCCGGCCTTCTCACGGCG
CACGCGCCCAAAGCCTCATATCAGTTCTTCGAAGTCACCGTCCAGCAGGAGGAAACCGAATGGCCCGAGATGCAC
AAGCGGAAACGGCAGTGGGTTTCGTATACACAGGCTGCCACTGCCCTTGCAAATCGGCCCGAGTTGCTTGAAGCC
TTGCATCGCAGCTCTTTAAAGCGGTAG
Transcript >Pro_DTO377G3_2|g9188.t1
ATGGCTCAAATACGGTCTATGGAAGCCCGCGTTGGGCGGAAAAACCAACGCTACGGCTCAAAAGGCGAGCGACTG
GTAGCCGGCGTTGTCCCTATTTCCGCCGACAAGACCAAAGTCCTCATGATTCAATCCGCAGGACCCGGAGGCTGG
GTGCTCCCCAAGGGCGGTTGGGAGCTCGATGAGAAAACTGCCGAGCAGGCTGCATGCCGTGAGGCCTGGGAGGAA
GCGGGTGTCATCTGTGTCGTGACCAGAGATCTGGGACTCATTCCGGACATGAGACCCTCCGGCCTTCTCACGGCG
CACGCGCCCAAAGCCTCATATCAGTTCTTCGAAGTCACCGTCCAGCAGGAGGAAACCGAATGGCCCGAGATGCAC
AAGCGGAAACGGCAGTGGGTTTCGTATACACAGGCTGCCACTGCCCTTGCAAATCGGCCCGAGTTGCTTGAAGCC
TTGCATCGCAGCTCTTTAAAGCGGTAG
Gene >Pro_DTO377G3_2|g9188.t1
ATGGCTCAAATACGGTCTATGGAAGCCCGCGTTGGGCGGAAAAACCAACGTGAGTTATCGCTGGTGTCGCTTTGC
GGCTGCGCACGTGGGGGGGCACCCGTACCCCTTACGTCTACACTGTCCCCGTGTTTCCTGACTCTAACGGCTTGG
CATAGGCTACGGCTCAAAAGGCGAGCGACTGGTAGCCGGCGTTGTCCCTATTTCCGCCGACAAGACCAAAGTCCT
CATGATTCAATCCGCAGGACCCGGAGGCTGGGTGCTCCCCAAGGGCGGTTGGGAGCTCGATGAGAAAACTGCCGA
GCAGGCTGCATGCCGTGAGGCCTGGGAGGAAGCGGGTGTCATCTGTGTCGTGACCAGAGATCTGGGACTCATTCC
GGACATGAGACCCTCCGGCCTTCTCACGGCGCACGCGCCCAAAGCCTCATATCAGTTCTTCGAAGTCACCGTCCA
GCAGGAGGAAACCGAATGGCCCGAGATGCACAAGCGGAAACGGCAGTGGGTTTCGTATACACAGGCTGCCACTGC
CCTTGCAAATCGGCCCGAGTTGCTTGAAGCCTTGCATCGCAGCTCTTTAAAGCGGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail