Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g9176.t1
Gene name
Locationscaffold_43:13973..16030
Strand-
Gene length (bp)2057
Transcript length (bp)1650
Coding sequence length (bp)1650
Protein length (aa) 550

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00006 ATP-synt_ab ATP synthase alpha/beta family, nucleotide-binding domain 6.2E-69 195 421
PF02874 ATP-synt_ab_N ATP synthase alpha/beta family, beta-barrel domain 5.6E-12 75 138

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:1902600 proton transmembrane transport Yes
GO:0046034 ATP metabolic process Yes
GO:0098662 inorganic cation transmembrane transport No
GO:0009117 nucleotide metabolic process No
GO:0098655 cation transmembrane transport No
GO:0032559 adenyl ribonucleotide binding No
GO:0044238 primary metabolic process No
GO:0043168 anion binding No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0009144 purine nucleoside triphosphate metabolic process No
GO:0019637 organophosphate metabolic process No
GO:0009987 cellular process No
GO:0034220 ion transmembrane transport No
GO:0006139 nucleobase-containing compound metabolic process No
GO:1901265 nucleoside phosphate binding No
GO:1901564 organonitrogen compound metabolic process No
GO:0055085 transmembrane transport No
GO:1901360 organic cyclic compound metabolic process No
GO:0032553 ribonucleotide binding No
GO:0071704 organic substance metabolic process No
GO:0051234 establishment of localization No
GO:0097159 organic cyclic compound binding No
GO:0032555 purine ribonucleotide binding No
GO:0006793 phosphorus metabolic process No
GO:0009259 ribonucleotide metabolic process No
GO:1901363 heterocyclic compound binding No
GO:0055086 nucleobase-containing small molecule metabolic process No
GO:0072521 purine-containing compound metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0051179 localization No
GO:0006812 cation transport No
GO:0008144 drug binding No
GO:0017144 drug metabolic process No
GO:0036094 small molecule binding No
GO:0019693 ribose phosphate metabolic process No
GO:0044237 cellular metabolic process No
GO:0006796 phosphate-containing compound metabolic process No
GO:0005488 binding No
GO:0006725 cellular aromatic compound metabolic process No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0015672 monovalent inorganic cation transport No
GO:0006811 ion transport No
GO:0043167 ion binding No
GO:0006807 nitrogen compound metabolic process No
GO:0003674 molecular_function No
GO:0000166 nucleotide binding No
GO:0009199 ribonucleoside triphosphate metabolic process No
GO:0009205 purine ribonucleoside triphosphate metabolic process No
GO:0006163 purine nucleotide metabolic process No
GO:0008150 biological_process No
GO:0009150 purine ribonucleotide metabolic process No
GO:0044281 small molecule metabolic process No
GO:1901135 carbohydrate derivative metabolic process No
GO:0008152 metabolic process No
GO:0006753 nucleoside phosphate metabolic process No
GO:0098660 inorganic ion transmembrane transport No
GO:0006810 transport No
GO:0030554 adenyl nucleotide binding No
GO:0097367 carbohydrate derivative binding No
GO:0009141 nucleoside triphosphate metabolic process No
GO:0017076 purine nucleotide binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 54 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g9176.t1
MTRPTHLITCNVTAQAPPSRQLDQPPSPTFALFPILAFFYSEFRPWRIRFAMADSIDPRMPSIKPRFRYNTIGGI
NGPLVILDNIKFPRYNEIVSLTLPDGTERSGQVLEARGNRAVVQVFEGTSGIDVKKTKVEFSGHSLKLGVSEDML
GRTFDGSGRAIDKGPKVLAEEYLDINGQPINPYSRVYPEEIISTGISAIDTMNSIARGQKIPIFSAAGLPHSELA
AQICRQASLAKPTKDVHDGHEENFSIVFAAMGVNMETARFFKRDFEENGSMERVTLFLNLANDPTIERIITPRLA
LTTAEYYAYQLEKHVLVIMTDMSAYCDALREVSAAREEVPGRRGYPGYMYTDLSTLYERAGRVQGRNGSITQIPI
LTMPNDDITHPIPDLTGYITEGQIFVDRQLDNRGIYPPINVLPSLSRLMKSAIGEGRTRKDHSDVSNQLYAKYAI
GRDAAAMKAVVGEEALSSEDKLSLEFLEKFERTFISQSPYESRTIEESLDLAWSLLRIYPRELLNRIPKRILDEF
YARHARKIPNKDTRDNSHENLIDA*
Coding >Pro_DTO377G3_2|g9176.t1
ATGACCCGGCCTACGCACCTCATCACGTGCAACGTCACCGCCCAAGCTCCCCCATCGAGACAGCTGGACCAACCC
CCCAGTCCCACCTTTGCTCTATTCCCCATCCTTGCATTTTTCTACTCTGAATTTCGCCCGTGGAGGATCAGATTC
GCTATGGCCGACTCTATTGACCCCCGGATGCCCTCCATCAAACCCCGGTTCCGTTACAATACCATCGGAGGCATT
AACGGACCGCTGGTTATCCTCGACAATATCAAGTTTCCCCGTTATAACGAGATCGTGTCCCTGACGCTCCCCGAT
GGCACAGAGCGCAGTGGTCAAGTGCTGGAAGCCAGAGGAAACCGGGCTGTTGTTCAGGTGTTCGAAGGCACTTCC
GGTATCGATGTGAAGAAGACCAAAGTCGAGTTTAGCGGCCACAGCTTGAAACTTGGCGTCTCCGAGGACATGTTG
GGTCGAACATTCGATGGCTCAGGTCGAGCTATTGATAAGGGTCCTAAGGTGTTAGCGGAGGAGTACTTAGATATC
AACGGCCAGCCTATCAACCCCTACTCACGAGTGTACCCCGAGGAGATCATTTCGACTGGTATCTCCGCTATCGAT
ACGATGAACTCCATTGCTCGTGGACAGAAGATCCCTATCTTCTCGGCTGCCGGTCTTCCACACTCGGAGCTAGCA
GCACAGATTTGCCGGCAAGCCAGTCTAGCTAAGCCCACTAAGGATGTTCACGACGGCCACGAGGAGAACTTCTCC
ATCGTCTTCGCCGCCATGGGTGTTAATATGGAGACAGCCCGTTTCTTCAAGCGCGACTTCGAGGAGAACGGCAGT
ATGGAGCGTGTCACTCTATTCCTGAACTTGGCCAACGACCCTACTATTGAGCGTATTATTACTCCTCGTCTTGCC
CTGACCACCGCCGAATACTACGCATACCAGCTCGAGAAGCACGTCCTGGTTATTATGACTGACATGTCGGCCTAT
TGTGATGCCCTACGTGAAGTCTCTGCTGCCAGAGAAGAAGTCCCCGGTCGTCGTGGTTACCCTGGTTACATGTAC
ACAGATTTGTCCACCCTCTACGAGCGTGCTGGACGAGTACAGGGCCGTAATGGTTCTATTACACAGATTCCCATT
CTGACCATGCCTAACGATGATATCACCCACCCCATTCCCGATTTGACTGGTTACATTACCGAGGGCCAGATCTTT
GTTGACCGTCAGCTGGACAACCGCGGTATCTACCCACCAATCAACGTCCTGCCATCTCTATCCCGTCTGATGAAG
TCCGCCATCGGCGAGGGCCGCACCCGCAAGGACCACTCAGATGTGTCTAACCAGCTGTACGCCAAGTACGCCATT
GGTCGTGATGCCGCCGCCATGAAAGCCGTTGTCGGAGAAGAAGCCCTCTCCTCGGAAGATAAGCTCTCCCTAGAA
TTCCTCGAGAAGTTCGAGCGCACCTTCATCAGCCAGTCTCCCTACGAGTCGCGCACCATCGAAGAATCCCTCGAC
CTCGCCTGGAGCCTCCTCCGCATCTACCCTAGGGAACTCCTCAACCGTATCCCCAAGCGCATTCTCGACGAGTTC
TACGCCCGCCACGCCCGTAAGATCCCTAACAAGGATACCCGCGATAACTCGCATGAGAACTTGATCGACGCATGA
Transcript >Pro_DTO377G3_2|g9176.t1
ATGACCCGGCCTACGCACCTCATCACGTGCAACGTCACCGCCCAAGCTCCCCCATCGAGACAGCTGGACCAACCC
CCCAGTCCCACCTTTGCTCTATTCCCCATCCTTGCATTTTTCTACTCTGAATTTCGCCCGTGGAGGATCAGATTC
GCTATGGCCGACTCTATTGACCCCCGGATGCCCTCCATCAAACCCCGGTTCCGTTACAATACCATCGGAGGCATT
AACGGACCGCTGGTTATCCTCGACAATATCAAGTTTCCCCGTTATAACGAGATCGTGTCCCTGACGCTCCCCGAT
GGCACAGAGCGCAGTGGTCAAGTGCTGGAAGCCAGAGGAAACCGGGCTGTTGTTCAGGTGTTCGAAGGCACTTCC
GGTATCGATGTGAAGAAGACCAAAGTCGAGTTTAGCGGCCACAGCTTGAAACTTGGCGTCTCCGAGGACATGTTG
GGTCGAACATTCGATGGCTCAGGTCGAGCTATTGATAAGGGTCCTAAGGTGTTAGCGGAGGAGTACTTAGATATC
AACGGCCAGCCTATCAACCCCTACTCACGAGTGTACCCCGAGGAGATCATTTCGACTGGTATCTCCGCTATCGAT
ACGATGAACTCCATTGCTCGTGGACAGAAGATCCCTATCTTCTCGGCTGCCGGTCTTCCACACTCGGAGCTAGCA
GCACAGATTTGCCGGCAAGCCAGTCTAGCTAAGCCCACTAAGGATGTTCACGACGGCCACGAGGAGAACTTCTCC
ATCGTCTTCGCCGCCATGGGTGTTAATATGGAGACAGCCCGTTTCTTCAAGCGCGACTTCGAGGAGAACGGCAGT
ATGGAGCGTGTCACTCTATTCCTGAACTTGGCCAACGACCCTACTATTGAGCGTATTATTACTCCTCGTCTTGCC
CTGACCACCGCCGAATACTACGCATACCAGCTCGAGAAGCACGTCCTGGTTATTATGACTGACATGTCGGCCTAT
TGTGATGCCCTACGTGAAGTCTCTGCTGCCAGAGAAGAAGTCCCCGGTCGTCGTGGTTACCCTGGTTACATGTAC
ACAGATTTGTCCACCCTCTACGAGCGTGCTGGACGAGTACAGGGCCGTAATGGTTCTATTACACAGATTCCCATT
CTGACCATGCCTAACGATGATATCACCCACCCCATTCCCGATTTGACTGGTTACATTACCGAGGGCCAGATCTTT
GTTGACCGTCAGCTGGACAACCGCGGTATCTACCCACCAATCAACGTCCTGCCATCTCTATCCCGTCTGATGAAG
TCCGCCATCGGCGAGGGCCGCACCCGCAAGGACCACTCAGATGTGTCTAACCAGCTGTACGCCAAGTACGCCATT
GGTCGTGATGCCGCCGCCATGAAAGCCGTTGTCGGAGAAGAAGCCCTCTCCTCGGAAGATAAGCTCTCCCTAGAA
TTCCTCGAGAAGTTCGAGCGCACCTTCATCAGCCAGTCTCCCTACGAGTCGCGCACCATCGAAGAATCCCTCGAC
CTCGCCTGGAGCCTCCTCCGCATCTACCCTAGGGAACTCCTCAACCGTATCCCCAAGCGCATTCTCGACGAGTTC
TACGCCCGCCACGCCCGTAAGATCCCTAACAAGGATACCCGCGATAACTCGCATGAGAACTTGATCGACGCATGA
Gene >Pro_DTO377G3_2|g9176.t1
ATGACCCGGCCTACGCACCTCATCACGTGCAACGTCACCGCCCAAGCTCCCCCATCGAGACAGCTGGACCAACCC
CCCAGTCCCACCTTTGCTCTATTCCCCATCCTTGCATTTTTCTACTCTGAATTTCGCCCGTGGAGGATCAGATTC
GCTATGGCCGACTCTATTGACCCCCGGATGCCCTCCATCAAACCCCGGTTCCGTTACAATACCATCGGAGGCATT
AACGGACCGCTGGTTATCCTCGACAATGTGAGTTGACGATGTCCTGACAATGAAGCGGGAACTGTATGCTAATGA
TAAAATTGTCAAACAGATCAAGTTTCCCCGTTATAACGAGATCGTGTCCCTGACGCTCCCCGATGGCACAGAGCG
CAGTGGTCAAGTGCTGGAAGCCAGAGGTCCGTTCCCCACATTCTGCCGTTCCGACTAGGAGTATGAAAGCTGACT
GCTATATATACAAATAGGAAACCGGGCTGTTGTTCAGGTGCGGACTAATACCTCGTCGCTAACATGAAAGACTTT
GAATTAACGTGGCTCGTTTGTGAATTAGGTGTTCGAAGGCACTTCCGGTATCGATGTGAAGAAGGTACAACTATC
CGTTGAAATGGTTTGAATATGTGCTGACATATCGTTAGACCAAAGTCGAGTTTAGCGGCCACAGCTTGAAACTTG
GCGTCTCCGAGGACATGTTGGGTCGAACATTCGATGGCTCAGGTCGAGCTATTGATAAGGGTCCTAAGGTGTTAG
CGGAGGAGTACTTAGATATCAACGGCCAGCCTATCAACCCCTACTCACGAGTATGCGCACTTTCACCGATCTAAG
ATGGAACTACGGAAAGCTGACGAACGGATAAGGTGTACCCCGAGGAGATCATTTCGACTGGTATCTCCGCTATCG
ATACGATGAACTCCATTGCTCGTGGACAGAAGATCCCTATCTTCTCGGCTGCCGGTCTTCCACACTCGGAGCTAG
CAGCACAGATTTGCCGGCAAGCCAGTCTAGCTAAGCCCACTAAGGATGTTCACGACGGCCACGAGGAGAACTTCT
CCATCGTCTTCGCCGCCATGGGTGTTAATATGGAGACAGCCCGTTTCTTCAAGCGCGACTTCGAGGAGAACGGCA
GTATGGAGCGTGTCACTCTATTCCTGAACTTGGCCAACGACCCTACTATTGAGCGTATTATTACTCCTCGTCTTG
CCCTGACCACCGCCGAATACTACGCATACCAGCTCGAGAAGCACGTCCTGGTTATTATGACTGACATGTCGGCCT
ATTGTGATGCCCTACGTGAAGTCTCTGCTGCCAGAGAAGAAGTCCCCGGTCGTCGTGGTTACCCTGGTTACATGT
ACACAGATTTGTCCACCCTCTACGAGCGTGCTGGACGAGTACAGGGCCGTAATGGTTCTATTACACAGATTCCCA
TTCTGACCATGCCTAACGATGGTGCGTTTCTTAAGTCACACTTTCAGCGAATACAACTAACCCATACCTTCAGAT
ATCACCCACCCCATTCCCGATTTGACTGGTTACATTACCGAGGGCCAGATCTTTGTTGACCGTCAGCTGGACAAC
CGCGGTATCTACCCACCAATCAACGTCCTGCCATCTCTATCCCGTCTGATGAAGTCCGCCATCGGCGAGGGCCGC
ACCCGCAAGGACCACTCAGATGTGTCTAACCAGCTGTACGCCAAGTACGCCATTGGTCGTGATGCCGGTAAGCAG
CCCACCCTTCCACATCCCACAAACATCTCTAACCACTCCAACCAGCCGCCATGAAAGCCGTTGTCGGAGAAGAAG
CCCTCTCCTCGGAAGATAAGCTCTCCCTAGAATTCCTCGAGAAGTTCGAGCGCACCTTCATCAGCCAGTCTCCCT
ACGAGTCGCGCACCATCGAAGAATCCCTCGACCTCGCCTGGAGCCTCCTCCGCATCTACCCTAGGGAACTCCTCA
ACCGTATCCCCAAGCGCATTCTCGACGAGTTCTACGCCCGCCACGCCCGTAAGATCCCTAACAAGGATACCCGCG
ATAACTCGCATGAGAACTTGATCGACGCATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail