Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g9175.t1
Gene name
Locationscaffold_43:11155..13470
Strand+
Gene length (bp)2315
Transcript length (bp)2172
Coding sequence length (bp)2172
Protein length (aa) 724

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00290 Trp_syntA Tryptophan synthase alpha chain 1.8E-95 8 256
PF00291 PALP Pyridoxal-phosphate dependent enzyme 3.7E-50 374 697

GO

GO Term Description Terminal node
GO:0004834 tryptophan synthase activity Yes
GO:0006568 tryptophan metabolic process Yes
GO:0044106 cellular amine metabolic process No
GO:0006586 indolalkylamine metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0016836 hydro-lyase activity No
GO:0009308 amine metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0009072 aromatic amino acid family metabolic process No
GO:0016829 lyase activity No
GO:0019752 carboxylic acid metabolic process No
GO:0071704 organic substance metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0003824 catalytic activity No
GO:1901605 alpha-amino acid metabolic process No
GO:0044238 primary metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0009987 cellular process No
GO:0006576 cellular biogenic amine metabolic process No
GO:0043436 oxoacid metabolic process No
GO:0006520 cellular amino acid metabolic process No
GO:0006082 organic acid metabolic process No
GO:0008152 metabolic process No
GO:0044281 small molecule metabolic process No
GO:0016835 carbon-oxygen lyase activity No
GO:0008150 biological_process No
GO:0003674 molecular_function No
GO:0006807 nitrogen compound metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0042430 indole-containing compound metabolic process No
GO:0044237 cellular metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 34 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g9175.t1
MEAIKQTFAKCKAQNRAALVAYITAGYPTVEEAVDILLGLENGGADIIELGIPFTDPIADGPTIQTANTKALENG
VTLTTVLELVRTARSRGLQTPLMLMGYFNPVLKYGEERMLRDCKEAGVNGFIMVDLPPEEAVRFRDLCSSAGLSY
VPLIAPATSDARMRLLCKIADSFIYVVSRMGVTGATGSLSANIPELLHRVHEYSGNVPAALGFGVSTREHFLSVQ
EQAEGVVIGSQIITCVGKAPAGQAAKAAEEYLSSITGRKRERDATGALTHEINVLEAIQKAQPSAQVQPTKVITD
SDTPAGPGLADQLEALNVTKDASAQPSRFGEFGGQYVPESLMDCLAELEHGFNIANNDPNFWEEFRSYYPYMGRP
SSLHMAQRLTDHVGGANIWLKREDLNHTGSHKINNALGQILIARRLGKTRIIAETGAGQHGVATATVCAKFGMQC
TVFMGAEDVRRQGLNVFRMKLLGASVIAVEAGSRTLRDAVNEALRAWVVELDTTHYIIGSAIGPHPFPTIVRTFQ
SVIGNETKEQMQAQIGKLPDAVIACVGGGSNAVGMFYPFSNDPSVKLIGVEAAGDGIDTNRHSATLSGGSHGVLH
GVRTYVLQNEHGQISDTHSISAGLDYPGVGPELSNWKDTNRATFIAADDSQALAGFRALAQHEGIIPALESSHAV
WGVMQVAKTMGKGQNIVLNLSGRGDKDVQQVADELPRLGPKIGWDLRF*
Coding >Pro_DTO377G3_2|g9175.t1
ATGGAAGCTATCAAGCAGACCTTCGCGAAGTGCAAGGCACAGAACCGTGCAGCCCTTGTGGCCTATATTACCGCA
GGATACCCCACCGTTGAGGAGGCCGTTGATATCCTCCTCGGTCTCGAGAACGGCGGCGCCGATATCATCGAGCTT
GGCATTCCGTTCACAGATCCCATCGCCGATGGCCCCACCATTCAGACCGCTAACACAAAGGCTCTTGAGAATGGT
GTTACCCTCACTACCGTCCTTGAGCTTGTCCGCACTGCCCGCAGCCGCGGTCTGCAGACCCCGCTGATGCTCATG
GGTTACTTCAACCCTGTCCTTAAGTACGGTGAGGAGCGTATGCTCCGTGATTGCAAGGAGGCTGGTGTCAATGGT
TTTATCATGGTTGACTTGCCCCCGGAGGAGGCTGTCCGTTTCCGTGACCTTTGCTCAAGCGCTGGTCTCTCCTAC
GTCCCCCTTATCGCCCCTGCCACTTCTGATGCTCGCATGCGTCTCCTCTGCAAGATCGCAGACAGCTTTATCTAT
GTCGTCTCCCGCATGGGTGTGACCGGTGCCACTGGTTCATTGAGCGCAAACATCCCCGAGCTTCTGCACCGCGTC
CACGAATACTCCGGCAACGTCCCTGCTGCATTGGGATTCGGTGTCAGCACCCGTGAGCACTTCCTGTCCGTCCAG
GAGCAGGCTGAGGGTGTTGTCATTGGCAGCCAAATTATCACTTGCGTTGGTAAGGCCCCTGCTGGGCAGGCTGCC
AAGGCTGCCGAGGAGTACCTTTCCAGCATCACTGGACGCAAACGTGAGCGTGATGCCACCGGTGCTCTGACTCAC
GAGATCAATGTTCTCGAGGCCATTCAGAAGGCCCAGCCCTCTGCTCAGGTTCAACCTACTAAAGTGATCACCGAT
TCCGACACCCCCGCCGGACCTGGTCTCGCCGACCAGCTCGAGGCCCTCAATGTCACAAAGGATGCATCTGCCCAG
CCCTCGCGCTTCGGTGAGTTCGGTGGACAGTATGTCCCCGAGTCCCTTATGGATTGCTTGGCCGAGCTCGAGCAC
GGCTTCAATATTGCCAACAACGATCCCAATTTCTGGGAAGAATTCCGCTCCTACTACCCCTACATGGGCCGTCCC
AGCAGCCTGCACATGGCCCAGCGTTTGACCGACCACGTTGGCGGCGCCAACATCTGGTTGAAGCGCGAGGATCTT
AACCACACTGGAAGTCACAAGATCAACAATGCTCTTGGACAGATTTTGATTGCCCGTCGCCTGGGCAAGACCCGC
ATTATTGCTGAGACCGGTGCTGGCCAGCACGGTGTTGCTACCGCCACAGTCTGCGCCAAGTTCGGCATGCAGTGT
ACCGTCTTCATGGGTGCTGAAGATGTGCGTCGCCAAGGTCTCAATGTCTTCCGCATGAAGCTCCTCGGTGCCTCC
GTCATTGCCGTCGAGGCTGGAAGCCGCACTCTTCGTGATGCGGTCAACGAGGCTCTCCGCGCCTGGGTCGTCGAA
CTCGACACCACCCACTACATCATCGGCTCCGCCATCGGCCCCCACCCATTCCCCACCATCGTCCGCACCTTCCAG
TCCGTGATCGGCAACGAAACCAAGGAGCAGATGCAGGCGCAGATTGGCAAACTCCCCGATGCCGTCATCGCCTGT
GTCGGCGGTGGTTCCAACGCAGTCGGCATGTTCTACCCCTTCTCCAATGACCCAAGCGTCAAGCTCATCGGTGTC
GAGGCTGCTGGTGACGGCATTGACACCAACCGCCACTCTGCCACCCTCTCCGGTGGCTCCCACGGTGTCCTCCAC
GGCGTGCGCACCTATGTCCTGCAGAACGAGCACGGGCAGATCTCAGACACCCACTCAATCTCTGCTGGTCTCGAC
TACCCCGGTGTCGGCCCCGAACTCAGCAACTGGAAGGATACCAACCGCGCCACCTTCATCGCCGCCGACGACAGC
CAGGCCCTCGCTGGATTCCGCGCCCTCGCCCAACACGAGGGTATCATCCCCGCCCTGGAGTCCTCGCACGCCGTC
TGGGGTGTGATGCAAGTCGCCAAGACAATGGGCAAGGGCCAGAACATTGTTCTGAACCTGAGTGGTCGCGGTGAC
AAGGATGTCCAGCAGGTCGCCGACGAGCTTCCTCGATTGGGCCCTAAGATCGGCTGGGATCTGCGCTTCTGA
Transcript >Pro_DTO377G3_2|g9175.t1
ATGGAAGCTATCAAGCAGACCTTCGCGAAGTGCAAGGCACAGAACCGTGCAGCCCTTGTGGCCTATATTACCGCA
GGATACCCCACCGTTGAGGAGGCCGTTGATATCCTCCTCGGTCTCGAGAACGGCGGCGCCGATATCATCGAGCTT
GGCATTCCGTTCACAGATCCCATCGCCGATGGCCCCACCATTCAGACCGCTAACACAAAGGCTCTTGAGAATGGT
GTTACCCTCACTACCGTCCTTGAGCTTGTCCGCACTGCCCGCAGCCGCGGTCTGCAGACCCCGCTGATGCTCATG
GGTTACTTCAACCCTGTCCTTAAGTACGGTGAGGAGCGTATGCTCCGTGATTGCAAGGAGGCTGGTGTCAATGGT
TTTATCATGGTTGACTTGCCCCCGGAGGAGGCTGTCCGTTTCCGTGACCTTTGCTCAAGCGCTGGTCTCTCCTAC
GTCCCCCTTATCGCCCCTGCCACTTCTGATGCTCGCATGCGTCTCCTCTGCAAGATCGCAGACAGCTTTATCTAT
GTCGTCTCCCGCATGGGTGTGACCGGTGCCACTGGTTCATTGAGCGCAAACATCCCCGAGCTTCTGCACCGCGTC
CACGAATACTCCGGCAACGTCCCTGCTGCATTGGGATTCGGTGTCAGCACCCGTGAGCACTTCCTGTCCGTCCAG
GAGCAGGCTGAGGGTGTTGTCATTGGCAGCCAAATTATCACTTGCGTTGGTAAGGCCCCTGCTGGGCAGGCTGCC
AAGGCTGCCGAGGAGTACCTTTCCAGCATCACTGGACGCAAACGTGAGCGTGATGCCACCGGTGCTCTGACTCAC
GAGATCAATGTTCTCGAGGCCATTCAGAAGGCCCAGCCCTCTGCTCAGGTTCAACCTACTAAAGTGATCACCGAT
TCCGACACCCCCGCCGGACCTGGTCTCGCCGACCAGCTCGAGGCCCTCAATGTCACAAAGGATGCATCTGCCCAG
CCCTCGCGCTTCGGTGAGTTCGGTGGACAGTATGTCCCCGAGTCCCTTATGGATTGCTTGGCCGAGCTCGAGCAC
GGCTTCAATATTGCCAACAACGATCCCAATTTCTGGGAAGAATTCCGCTCCTACTACCCCTACATGGGCCGTCCC
AGCAGCCTGCACATGGCCCAGCGTTTGACCGACCACGTTGGCGGCGCCAACATCTGGTTGAAGCGCGAGGATCTT
AACCACACTGGAAGTCACAAGATCAACAATGCTCTTGGACAGATTTTGATTGCCCGTCGCCTGGGCAAGACCCGC
ATTATTGCTGAGACCGGTGCTGGCCAGCACGGTGTTGCTACCGCCACAGTCTGCGCCAAGTTCGGCATGCAGTGT
ACCGTCTTCATGGGTGCTGAAGATGTGCGTCGCCAAGGTCTCAATGTCTTCCGCATGAAGCTCCTCGGTGCCTCC
GTCATTGCCGTCGAGGCTGGAAGCCGCACTCTTCGTGATGCGGTCAACGAGGCTCTCCGCGCCTGGGTCGTCGAA
CTCGACACCACCCACTACATCATCGGCTCCGCCATCGGCCCCCACCCATTCCCCACCATCGTCCGCACCTTCCAG
TCCGTGATCGGCAACGAAACCAAGGAGCAGATGCAGGCGCAGATTGGCAAACTCCCCGATGCCGTCATCGCCTGT
GTCGGCGGTGGTTCCAACGCAGTCGGCATGTTCTACCCCTTCTCCAATGACCCAAGCGTCAAGCTCATCGGTGTC
GAGGCTGCTGGTGACGGCATTGACACCAACCGCCACTCTGCCACCCTCTCCGGTGGCTCCCACGGTGTCCTCCAC
GGCGTGCGCACCTATGTCCTGCAGAACGAGCACGGGCAGATCTCAGACACCCACTCAATCTCTGCTGGTCTCGAC
TACCCCGGTGTCGGCCCCGAACTCAGCAACTGGAAGGATACCAACCGCGCCACCTTCATCGCCGCCGACGACAGC
CAGGCCCTCGCTGGATTCCGCGCCCTCGCCCAACACGAGGGTATCATCCCCGCCCTGGAGTCCTCGCACGCCGTC
TGGGGTGTGATGCAAGTCGCCAAGACAATGGGCAAGGGCCAGAACATTGTTCTGAACCTGAGTGGTCGCGGTGAC
AAGGATGTCCAGCAGGTCGCCGACGAGCTTCCTCGATTGGGCCCTAAGATCGGCTGGGATCTGCGCTTCTGA
Gene >Pro_DTO377G3_2|g9175.t1
ATGGAAGCTATCAAGCAGACCTTCGCGAAGTGCAAGGCACAGAACCGTGCAGCCCTTGTGGCCTATATTACCGCA
GGATACCCCACCGTTGAGGAGGCCGTTGATATCCTCCTCGGTCTCGAGAACGGCGGCGCCGGTAATTCAACCCCA
AGTGAAAGTTGATCAAAGGGATGACCTTTACTAACATTCGGTCTCATATCACAGATATCATCGAGCTTGGCATTC
CGTTCACAGATCCCATCGCCGATGGCCCCACCATTCAGACCGCTAACACAAAGGCTCTTGAGAATGGTGTTACCC
TCACTACCGTCCTTGAGCTTGTCCGCACTGCCCGCAGCCGCGGTCTGCAGACCCCGCTGATGCTCATGGGTTACT
TCAACCCTGTCCTTAAGTACGGTGAGGAGCGTATGCTCCGTGATTGCAAGGAGGCTGGTGTCAATGGTTTTATCA
TGGTTGACTTGCCCCCGGAGGAGGCTGTCCGTTTCCGTGACCTTTGCTCAAGCGCTGGGTGAGTTCCTTGATTTT
TACTCTTCAAATCTTTATCATTTGTCTATGATTATACAGCATGCTTACTCAATTTCAGTCTCTCCTACGTCCCCC
TTATCGCCCCTGCCACTTCTGATGCTCGCATGCGTCTCCTCTGCAAGATCGCAGACAGCTTTATCTATGTCGTCT
CCCGCATGGGTGTGACCGGTGCCACTGGTTCATTGAGCGCAAACATCCCCGAGCTTCTGCACCGCGTCCACGAAT
ACTCCGGCAACGTCCCTGCTGCATTGGGATTCGGTGTCAGCACCCGTGAGCACTTCCTGTCCGTCCAGGAGCAGG
CTGAGGGTGTTGTCATTGGCAGCCAAATTATCACTTGCGTTGGTAAGGCCCCTGCTGGGCAGGCTGCCAAGGCTG
CCGAGGAGTACCTTTCCAGCATCACTGGACGCAAACGTGAGCGTGATGCCACCGGTGCTCTGACTCACGAGATCA
ATGTTCTCGAGGCCATTCAGAAGGCCCAGCCCTCTGCTCAGGTTCAACCTACTAAAGTGATCACCGATTCCGACA
CCCCCGCCGGACCTGGTCTCGCCGACCAGCTCGAGGCCCTCAATGTCACAAAGGATGCATCTGCCCAGCCCTCGC
GCTTCGGTGAGTTCGGTGGACAGTATGTCCCCGAGTCCCTTATGGATTGCTTGGCCGAGCTCGAGCACGGCTTCA
ATATTGCCAACAACGATCCCAATTTCTGGGAAGAATTCCGCTCCTACTACCCCTACATGGGCCGTCCCAGCAGCC
TGCACATGGCCCAGCGTTTGACCGACCACGTTGGCGGCGCCAACATCTGGTTGAAGCGCGAGGATCTTAACCACA
CTGGAAGTCACAAGATCAACAATGCTCTTGGACAGATTTTGATTGCCCGTCGCCTGGGCAAGACCCGCATTATTG
CTGAGACCGGTGCTGGCCAGCACGGTGTTGCTACCGCCACAGTCTGCGCCAAGTTCGGCATGCAGTGTACCGTCT
TCATGGGTGCTGAAGATGTGCGTCGCCAAGGTCTCAATGTCTTCCGCATGAAGCTCCTCGGTGCCTCCGTCATTG
CCGTCGAGGCTGGAAGCCGCACTCTTCGTGATGCGGTCAACGAGGCTCTCCGCGCCTGGGTCGTCGAACTCGACA
CCACCCACTACATCATCGGCTCCGCCATCGGCCCCCACCCATTCCCCACCATCGTCCGCACCTTCCAGTCCGTGA
TCGGCAACGAAACCAAGGAGCAGATGCAGGCGCAGATTGGCAAACTCCCCGATGCCGTCATCGCCTGTGTCGGCG
GTGGTTCCAACGCAGTCGGCATGTTCTACCCCTTCTCCAATGACCCAAGCGTCAAGCTCATCGGTGTCGAGGCTG
CTGGTGACGGCATTGACACCAACCGCCACTCTGCCACCCTCTCCGGTGGCTCCCACGGTGTCCTCCACGGCGTGC
GCACCTATGTCCTGCAGAACGAGCACGGGCAGATCTCAGACACCCACTCAATCTCTGCTGGTCTCGACTACCCCG
GTGTCGGCCCCGAACTCAGCAACTGGAAGGATACCAACCGCGCCACCTTCATCGCCGCCGACGACAGCCAGGCCC
TCGCTGGATTCCGCGCCCTCGCCCAACACGAGGGTATCATCCCCGCCCTGGAGTCCTCGCACGCCGTCTGGGGTG
TGATGCAAGTCGCCAAGACAATGGGCAAGGGCCAGAACATTGTTCTGAACCTGAGTGGTCGCGGTGACAAGGATG
TCCAGCAGGTCGCCGACGAGCTTCCTCGATTGGGCCCTAAGATCGGCTGGGATCTGCGCTTCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail