Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g9163.t1
Gene name
Locationscaffold_42:138627..140458
Strand-
Gene length (bp)1831
Transcript length (bp)1767
Coding sequence length (bp)1767
Protein length (aa) 589

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03151 TPT Triose-phosphate Transporter family 1.8E-22 136 449

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

Domain # Start End Length
1 131 150 19
2 165 187 22
3 219 238 19
4 248 270 22
5 277 294 17
6 298 320 22
7 333 355 22
8 375 397 22
9 404 426 22
10 430 448 18

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 92.29 56.66 127.92
5d_25C Five days - 25 degrees Celsius 192.90 114.07 271.72
7d_25C Seven days - 25 degrees Celsius 262.39 151.28 373.50
10d_25C Ten days - 25 degrees Celsius 533.53 288.18 778.87
7d_15C Seven days - 15 degrees Celsius 105.24 62.62 147.85
7d_30C Seven days - 30 degrees Celsius 232.79 136.36 329.21

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.000700 yes
3d_25C 7d_25C 0.000700 yes
3d_25C 7d_15C 0.634801 no
3d_25C 7d_30C 0.000700 yes
3d_25C 10d_25C 0.000700 yes
5d_25C 7d_25C 0.199147 no
5d_25C 7d_15C 0.001804 yes
5d_25C 7d_30C 0.478030 no
5d_25C 10d_25C 0.000700 yes
7d_25C 7d_15C 0.000700 yes
7d_25C 7d_30C 0.689548 no
7d_25C 10d_25C 0.002297 yes
7d_15C 7d_30C 0.000700 yes
7d_15C 10d_25C 0.000700 yes
7d_30C 10d_25C 0.000700 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g9163.t1
MGLSDGAHHRRRSSMVTGTGRASQPISTERNDTLWSHGDGGSHKREEQEPLTAEEDTDASDVLSAAETLELDPMS
SDDDQYDEETGLTTHQKRQRRRRRKQRRKLDARIADVKSHGTIREILSDRNVVKKLLINGGLILLWYLFSLSISI
YNKWMFSENDVVFPFPLFTTSLHMVVQFSLSSIILWIFPSLRPRRPVGSAATSPIDGPEEPQPLVSRLFYFTRLV
PCGAATSLDVGLGNMSLKFISLTFLTMCKSSALAFVLLFAFLFRLETPSTKLIIIIATMTVGVVMMVAGETAFNA
LGFALVIASAFFSGFRWGLTQILLLRHPATSNPFSTLFLLTPIMFLSLITIALSIEGPREIYQGYLALASKHGNL
FGSFLLIFPGVLAFCMISSEFALLKRSSVVTLSICGIFKEVVTISAAGIIFHDKLTTVNVTGLVVTISSIAAYNY
MKISGMRNELPEDDWSRESSPASDTDEGEHSTGDPGDYRQIAYPDSRIISPAPGSYLNDDHQSSSARVRSSGARR
GLSISTSIILENDGPSLKSAPATITTMAEAGFPHLHAPARQASPGLQSSSSVSPIRDQNVPQH*
Coding >Pro_DTO377G3_2|g9163.t1
ATGGGGCTCTCCGACGGCGCCCACCACCGTCGGCGAAGCTCCATGGTTACCGGGACAGGGCGAGCCTCACAACCG
ATTTCGACAGAGCGCAATGACACACTCTGGTCGCATGGAGACGGGGGAAGTCACAAACGCGAAGAACAAGAACCT
CTGACCGCCGAAGAGGATACCGATGCGTCCGATGTCTTATCCGCTGCAGAGACTCTGGAGTTGGACCCGATGAGT
TCGGATGATGACCAATATGACGAGGAAACCGGACTCACAACACATCAAAAACGCCAGCGACGTCGACGGCGAAAG
CAGCGCCGCAAGTTGGATGCTAGAATCGCGGACGTCAAGAGCCATGGTACTATTCGTGAGATTCTGTCGGACAGA
AATGTGGTCAAGAAGCTGTTAATCAACGGCGGGCTGATCTTGCTATGGTATCTCTTCTCACTGTCCATTTCAATA
TACAACAAATGGATGTTCTCCGAGAATGATGTCGTCTTCCCTTTCCCTCTTTTCACAACGAGCTTACACATGGTT
GTCCAATTCTCTCTCTCCTCTATAATACTCTGGATCTTTCCATCGCTCCGTCCGCGACGACCGGTAGGGTCTGCG
GCTACATCTCCCATCGATGGCCCCGAGGAACCACAACCCCTCGTTTCCAGATTATTCTACTTCACTCGCCTCGTT
CCGTGCGGTGCAGCAACGTCGCTTGACGTTGGTCTCGGAAACATGTCCTTGAAGTTCATCTCTCTGACTTTTTTA
ACCATGTGCAAATCGTCTGCACTTGCCTTCGTCCTGTTATTCGCCTTCCTTTTCCGTCTCGAAACACCTTCGACA
AAATTAATCATCATCATTGCCACCATGACAGTAGGTGTCGTGATGATGGTCGCTGGAGAGACAGCTTTCAATGCG
CTGGGCTTCGCACTTGTCATTGCCTCCGCGTTCTTTTCGGGCTTCCGATGGGGTCTGACACAAATTCTGCTGCTT
CGCCACCCGGCTACTTCCAATCCATTCTCAACTCTCTTTCTCCTGACTCCTATCATGTTCCTTTCACTCATCACC
ATCGCGCTATCTATTGAGGGTCCTCGTGAGATTTACCAAGGATACCTCGCGCTCGCCAGCAAACATGGGAACCTA
TTTGGTTCGTTCCTTCTGATTTTCCCTGGAGTACTTGCATTCTGCATGATTTCATCCGAGTTCGCGCTTCTAAAG
CGCTCCTCGGTTGTTACCCTCAGTATTTGCGGTATCTTCAAGGAAGTAGTCACAATCAGCGCCGCGGGCATTATC
TTCCACGATAAGCTCACAACCGTCAATGTGACCGGTTTGGTCGTCACTATCAGCAGCATTGCAGCGTACAATTAC
ATGAAAATTTCAGGAATGCGCAACGAGCTCCCGGAAGATGATTGGAGTCGCGAGTCCAGTCCTGCATCTGACACC
GACGAAGGTGAGCATAGCACTGGCGATCCCGGGGATTATCGTCAAATTGCCTATCCGGACTCCAGGATCATTAGC
CCTGCACCGGGTAGTTACCTTAACGATGATCACCAATCATCATCAGCCCGGGTACGTTCCAGTGGTGCCAGGCGT
GGTCTCTCAATATCGACTTCTATTATTCTAGAAAACGATGGTCCTTCTCTTAAATCAGCACCTGCGACTATCACT
ACAATGGCCGAGGCAGGGTTTCCCCACTTGCATGCCCCTGCTCGCCAAGCGTCGCCGGGCCTGCAATCGAGCTCG
TCTGTTTCGCCAATTCGGGATCAAAATGTCCCCCAGCACTAG
Transcript >Pro_DTO377G3_2|g9163.t1
ATGGGGCTCTCCGACGGCGCCCACCACCGTCGGCGAAGCTCCATGGTTACCGGGACAGGGCGAGCCTCACAACCG
ATTTCGACAGAGCGCAATGACACACTCTGGTCGCATGGAGACGGGGGAAGTCACAAACGCGAAGAACAAGAACCT
CTGACCGCCGAAGAGGATACCGATGCGTCCGATGTCTTATCCGCTGCAGAGACTCTGGAGTTGGACCCGATGAGT
TCGGATGATGACCAATATGACGAGGAAACCGGACTCACAACACATCAAAAACGCCAGCGACGTCGACGGCGAAAG
CAGCGCCGCAAGTTGGATGCTAGAATCGCGGACGTCAAGAGCCATGGTACTATTCGTGAGATTCTGTCGGACAGA
AATGTGGTCAAGAAGCTGTTAATCAACGGCGGGCTGATCTTGCTATGGTATCTCTTCTCACTGTCCATTTCAATA
TACAACAAATGGATGTTCTCCGAGAATGATGTCGTCTTCCCTTTCCCTCTTTTCACAACGAGCTTACACATGGTT
GTCCAATTCTCTCTCTCCTCTATAATACTCTGGATCTTTCCATCGCTCCGTCCGCGACGACCGGTAGGGTCTGCG
GCTACATCTCCCATCGATGGCCCCGAGGAACCACAACCCCTCGTTTCCAGATTATTCTACTTCACTCGCCTCGTT
CCGTGCGGTGCAGCAACGTCGCTTGACGTTGGTCTCGGAAACATGTCCTTGAAGTTCATCTCTCTGACTTTTTTA
ACCATGTGCAAATCGTCTGCACTTGCCTTCGTCCTGTTATTCGCCTTCCTTTTCCGTCTCGAAACACCTTCGACA
AAATTAATCATCATCATTGCCACCATGACAGTAGGTGTCGTGATGATGGTCGCTGGAGAGACAGCTTTCAATGCG
CTGGGCTTCGCACTTGTCATTGCCTCCGCGTTCTTTTCGGGCTTCCGATGGGGTCTGACACAAATTCTGCTGCTT
CGCCACCCGGCTACTTCCAATCCATTCTCAACTCTCTTTCTCCTGACTCCTATCATGTTCCTTTCACTCATCACC
ATCGCGCTATCTATTGAGGGTCCTCGTGAGATTTACCAAGGATACCTCGCGCTCGCCAGCAAACATGGGAACCTA
TTTGGTTCGTTCCTTCTGATTTTCCCTGGAGTACTTGCATTCTGCATGATTTCATCCGAGTTCGCGCTTCTAAAG
CGCTCCTCGGTTGTTACCCTCAGTATTTGCGGTATCTTCAAGGAAGTAGTCACAATCAGCGCCGCGGGCATTATC
TTCCACGATAAGCTCACAACCGTCAATGTGACCGGTTTGGTCGTCACTATCAGCAGCATTGCAGCGTACAATTAC
ATGAAAATTTCAGGAATGCGCAACGAGCTCCCGGAAGATGATTGGAGTCGCGAGTCCAGTCCTGCATCTGACACC
GACGAAGGTGAGCATAGCACTGGCGATCCCGGGGATTATCGTCAAATTGCCTATCCGGACTCCAGGATCATTAGC
CCTGCACCGGGTAGTTACCTTAACGATGATCACCAATCATCATCAGCCCGGGTACGTTCCAGTGGTGCCAGGCGT
GGTCTCTCAATATCGACTTCTATTATTCTAGAAAACGATGGTCCTTCTCTTAAATCAGCACCTGCGACTATCACT
ACAATGGCCGAGGCAGGGTTTCCCCACTTGCATGCCCCTGCTCGCCAAGCGTCGCCGGGCCTGCAATCGAGCTCG
TCTGTTTCGCCAATTCGGGATCAAAATGTCCCCCAGCACTAG
Gene >Pro_DTO377G3_2|g9163.t1
ATGGGGCTCTCCGACGGCGCCCACCACCGTCGGCGAAGCTCCATGGTTACCGGGACAGGGCGAGCCTCACAACCG
ATTTCGACAGAGCGCAATGACACACTCTGGTCGCATGGAGACGGGGGAAGTCACAAACGCGAAGAACAAGAACCT
CTGACCGCCGAAGAGGATACCGATGCGTCCGATGTCTTATCCGCTGCAGAGACTCTGGAGTTGGACCCGATGAGT
TCGGATGATGACCAATATGACGAGGAAACCGGACTCACAACACATCAAAAACGCCAGCGACGTCGACGGCGAAAG
CAGCGCCGCAAGTTGGATGCTAGAATCGCGGACGTCAAGAGCCATGGTACTATTCGTGAGATTCTGTCGGACAGA
AATGTGGTCAAGAAGCTGTTAATCAACGGCGGGCTGATCTTGCTATGGTATCTCTTCTCACTGTCCATTTCAATA
GTGAGTGGTTCTTTCCAGTATATTTGGAAGTCAAGAAGGAAACTAACAACTGTCATGTTTGCAGTACAACAAATG
GATGTTCTCCGAGAATGATGTCGTCTTCCCTTTCCCTCTTTTCACAACGAGCTTACACATGGTTGTCCAATTCTC
TCTCTCCTCTATAATACTCTGGATCTTTCCATCGCTCCGTCCGCGACGACCGGTAGGGTCTGCGGCTACATCTCC
CATCGATGGCCCCGAGGAACCACAACCCCTCGTTTCCAGATTATTCTACTTCACTCGCCTCGTTCCGTGCGGTGC
AGCAACGTCGCTTGACGTTGGTCTCGGAAACATGTCCTTGAAGTTCATCTCTCTGACTTTTTTAACCATGTGCAA
ATCGTCTGCACTTGCCTTCGTCCTGTTATTCGCCTTCCTTTTCCGTCTCGAAACACCTTCGACAAAATTAATCAT
CATCATTGCCACCATGACAGTAGGTGTCGTGATGATGGTCGCTGGAGAGACAGCTTTCAATGCGCTGGGCTTCGC
ACTTGTCATTGCCTCCGCGTTCTTTTCGGGCTTCCGATGGGGTCTGACACAAATTCTGCTGCTTCGCCACCCGGC
TACTTCCAATCCATTCTCAACTCTCTTTCTCCTGACTCCTATCATGTTCCTTTCACTCATCACCATCGCGCTATC
TATTGAGGGTCCTCGTGAGATTTACCAAGGATACCTCGCGCTCGCCAGCAAACATGGGAACCTATTTGGTTCGTT
CCTTCTGATTTTCCCTGGAGTACTTGCATTCTGCATGATTTCATCCGAGTTCGCGCTTCTAAAGCGCTCCTCGGT
TGTTACCCTCAGTATTTGCGGTATCTTCAAGGAAGTAGTCACAATCAGCGCCGCGGGCATTATCTTCCACGATAA
GCTCACAACCGTCAATGTGACCGGTTTGGTCGTCACTATCAGCAGCATTGCAGCGTACAATTACATGAAAATTTC
AGGAATGCGCAACGAGCTCCCGGAAGATGATTGGAGTCGCGAGTCCAGTCCTGCATCTGACACCGACGAAGGTGA
GCATAGCACTGGCGATCCCGGGGATTATCGTCAAATTGCCTATCCGGACTCCAGGATCATTAGCCCTGCACCGGG
TAGTTACCTTAACGATGATCACCAATCATCATCAGCCCGGGTACGTTCCAGTGGTGCCAGGCGTGGTCTCTCAAT
ATCGACTTCTATTATTCTAGAAAACGATGGTCCTTCTCTTAAATCAGCACCTGCGACTATCACTACAATGGCCGA
GGCAGGGTTTCCCCACTTGCATGCCCCTGCTCGCCAAGCGTCGCCGGGCCTGCAATCGAGCTCGTCTGTTTCGCC
AATTCGGGATCAAAATGTCCCCCAGCACTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail