Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g916.t1
Gene name
Locationscaffold_01:2427232..2427953
Strand-
Gene length (bp)721
Transcript length (bp)666
Coding sequence length (bp)666
Protein length (aa) 222

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02798 GST_N Glutathione S-transferase, N-terminal domain 2.3E-14 5 78
PF00043 GST_C Glutathione S-transferase, C-terminal domain 2.1E-12 110 198
PF13417 GST_N_3 Glutathione S-transferase, N-terminal domain 4.8E-09 8 78
PF13410 GST_C_2 Glutathione S-transferase, C-terminal domain 9.0E-09 134 196
PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain 5.6E-07 130 205
PF13409 GST_N_2 Glutathione S-transferase, N-terminal domain 1.3E-06 13 78

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0006749 glutathione metabolic process Yes
GO:0034641 cellular nitrogen compound metabolic process No
GO:0008150 biological_process No
GO:0005488 binding No
GO:0009987 cellular process No
GO:1901564 organonitrogen compound metabolic process No
GO:0044237 cellular metabolic process No
GO:0043603 cellular amide metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0008152 metabolic process No
GO:0006518 peptide metabolic process No
GO:0006790 sulfur compound metabolic process No
GO:0003674 molecular_function No
GO:0006575 cellular modified amino acid metabolic process No
GO:0071704 organic substance metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 39 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 104.46 59.79 149.14
5d_25C Five days - 25 degrees Celsius 103.85 59.83 147.87
7d_25C Seven days - 25 degrees Celsius 91.39 51.49 131.30
10d_25C Ten days - 25 degrees Celsius 85.55 47.76 123.33
7d_15C Seven days - 15 degrees Celsius 78.91 43.22 114.60
7d_30C Seven days - 30 degrees Celsius 112.52 65.63 159.41

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.987763 no
3d_25C 7d_25C 0.671449 no
3d_25C 7d_15C 0.288326 no
3d_25C 7d_30C 0.822315 no
3d_25C 10d_25C 0.474687 no
5d_25C 7d_25C 0.682146 no
5d_25C 7d_15C 0.289559 no
5d_25C 7d_30C 0.805926 no
5d_25C 10d_25C 0.480673 no
7d_25C 7d_15C 0.635435 no
7d_25C 7d_30C 0.450479 no
7d_25C 10d_25C 0.848395 no
7d_15C 7d_30C 0.156474 no
7d_15C 10d_25C 0.812199 no
7d_30C 10d_25C 0.278913 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g916.t1
MAPFGTIYSYQPSPRVMKALAAANLNGLEVAVPEFAMGKTNRTPDFLSKFPLGKVPAFEGADGTTLFESDAITQY
IAESGPAAAQLTGATSAERATIRQWICFAQGEILDPVTQLALPRLGIRPFDEKVEETNLARLERSLECLETHLKG
RTWFASKEKLSLADITVAAALVWGFSMAIDAEMRAKYPSVVAWYERTLETEGVKEAFGEKQFIEKRQDPKA*
Coding >Pro_DTO377G3_2|g916.t1
ATGGCACCATTCGGCACTATCTACTCTTATCAGCCCAGTCCCCGGGTCATGAAGGCCCTGGCCGCGGCCAACCTG
AACGGCCTAGAAGTGGCGGTTCCGGAATTCGCCATGGGCAAGACCAACCGGACCCCGGATTTCCTGTCCAAGTTC
CCTTTGGGTAAAGTGCCCGCCTTCGAGGGTGCCGACGGAACAACCCTATTCGAGTCAGACGCCATCACCCAATAC
ATTGCCGAGAGCGGCCCCGCTGCCGCTCAGCTTACTGGTGCTACCTCCGCCGAGCGCGCTACTATCCGCCAGTGG
ATCTGCTTTGCGCAGGGTGAGATTTTGGACCCTGTGACGCAGTTGGCGCTGCCGCGTCTCGGTATCCGGCCCTTC
GATGAGAAAGTCGAGGAGACCAACCTCGCGCGTCTGGAACGCTCGTTGGAATGTCTCGAGACTCACCTCAAGGGC
CGCACTTGGTTCGCGAGCAAGGAAAAGCTTAGCTTGGCTGATATCACCGTTGCCGCTGCCCTGGTCTGGGGTTTC
TCCATGGCTATCGATGCTGAAATGCGCGCAAAGTACCCCTCCGTGGTCGCTTGGTATGAGCGCACTCTCGAGACC
GAGGGCGTCAAGGAGGCCTTTGGTGAGAAGCAATTTATTGAGAAGCGTCAGGATCCCAAGGCTTAG
Transcript >Pro_DTO377G3_2|g916.t1
ATGGCACCATTCGGCACTATCTACTCTTATCAGCCCAGTCCCCGGGTCATGAAGGCCCTGGCCGCGGCCAACCTG
AACGGCCTAGAAGTGGCGGTTCCGGAATTCGCCATGGGCAAGACCAACCGGACCCCGGATTTCCTGTCCAAGTTC
CCTTTGGGTAAAGTGCCCGCCTTCGAGGGTGCCGACGGAACAACCCTATTCGAGTCAGACGCCATCACCCAATAC
ATTGCCGAGAGCGGCCCCGCTGCCGCTCAGCTTACTGGTGCTACCTCCGCCGAGCGCGCTACTATCCGCCAGTGG
ATCTGCTTTGCGCAGGGTGAGATTTTGGACCCTGTGACGCAGTTGGCGCTGCCGCGTCTCGGTATCCGGCCCTTC
GATGAGAAAGTCGAGGAGACCAACCTCGCGCGTCTGGAACGCTCGTTGGAATGTCTCGAGACTCACCTCAAGGGC
CGCACTTGGTTCGCGAGCAAGGAAAAGCTTAGCTTGGCTGATATCACCGTTGCCGCTGCCCTGGTCTGGGGTTTC
TCCATGGCTATCGATGCTGAAATGCGCGCAAAGTACCCCTCCGTGGTCGCTTGGTATGAGCGCACTCTCGAGACC
GAGGGCGTCAAGGAGGCCTTTGGTGAGAAGCAATTTATTGAGAAGCGTCAGGATCCCAAGGCTTAG
Gene >Pro_DTO377G3_2|g916.t1
ATGGCACCATTCGGCACTATCTACTCTTATCAGCCCAGTCCCCGGGTCATGAAGGTACCAATCTCGACCCCCTGT
CAGCATGCAATCACGCGCTAACAACCCCTGCTAGGCCCTGGCCGCGGCCAACCTGAACGGCCTAGAAGTGGCGGT
TCCGGAATTCGCCATGGGCAAGACCAACCGGACCCCGGATTTCCTGTCCAAGTTCCCTTTGGGTAAAGTGCCCGC
CTTCGAGGGTGCCGACGGAACAACCCTATTCGAGTCAGACGCCATCACCCAATACATTGCCGAGAGCGGCCCCGC
TGCCGCTCAGCTTACTGGTGCTACCTCCGCCGAGCGCGCTACTATCCGCCAGTGGATCTGCTTTGCGCAGGGTGA
GATTTTGGACCCTGTGACGCAGTTGGCGCTGCCGCGTCTCGGTATCCGGCCCTTCGATGAGAAAGTCGAGGAGAC
CAACCTCGCGCGTCTGGAACGCTCGTTGGAATGTCTCGAGACTCACCTCAAGGGCCGCACTTGGTTCGCGAGCAA
GGAAAAGCTTAGCTTGGCTGATATCACCGTTGCCGCTGCCCTGGTCTGGGGTTTCTCCATGGCTATCGATGCTGA
AATGCGCGCAAAGTACCCCTCCGTGGTCGCTTGGTATGAGCGCACTCTCGAGACCGAGGGCGTCAAGGAGGCCTT
TGGTGAGAAGCAATTTATTGAGAAGCGTCAGGATCCCAAGGCTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail