Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g916.t1
Gene name
Locationscaffold_01:2427232..2427953
Strand-
Gene length (bp)721
Transcript length (bp)666
Coding sequence length (bp)666
Protein length (aa) 222

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02798 GST_N Glutathione S-transferase, N-terminal domain 3.7E-15 5 78
PF00043 GST_C Glutathione S-transferase, C-terminal domain 1.6E-12 110 198
PF13417 GST_N_3 Glutathione S-transferase, N-terminal domain 2.5E-10 8 79
PF13410 GST_C_2 Glutathione S-transferase, C-terminal domain 9.6E-09 134 196
PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain 2.0E-07 127 205
PF13409 GST_N_2 Glutathione S-transferase, N-terminal domain 1.5E-06 13 78

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0005488 binding No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 39 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g916.t1
MAPFGTIYSYQPSPRVMKALAAANLNGLEVAVPEFAMGKTNRTPDFLSKFPLGKVPAFEGADGTTLFESDAITQY
IAESGPAAAQLTGATSAERATIRQWICFAQGEILDPVTQLALPRLGIRPFDEKVEETNLARLERSLECLETHLKG
RTWFASKEKLSLADITVAAALVWGFSMAIDAEMRAKYPSVVAWYERTLETEGVKEAFGEKQFIEKRQDPKA*
Coding >Pro_DTO377G3_2|g916.t1
ATGGCACCATTCGGCACTATCTACTCTTATCAGCCCAGTCCCCGGGTCATGAAGGCCCTGGCCGCGGCCAACCTG
AACGGCCTAGAAGTGGCGGTTCCGGAATTCGCCATGGGCAAGACCAACCGGACCCCGGATTTCCTGTCCAAGTTC
CCTTTGGGTAAAGTGCCCGCCTTCGAGGGTGCCGACGGAACAACCCTATTCGAGTCAGACGCCATCACCCAATAC
ATTGCCGAGAGCGGCCCCGCTGCCGCTCAGCTTACTGGTGCTACCTCCGCCGAGCGCGCTACTATCCGCCAGTGG
ATCTGCTTTGCGCAGGGTGAGATTTTGGACCCTGTGACGCAGTTGGCGCTGCCGCGTCTCGGTATCCGGCCCTTC
GATGAGAAAGTCGAGGAGACCAACCTCGCGCGTCTGGAACGCTCGTTGGAATGTCTCGAGACTCACCTCAAGGGC
CGCACTTGGTTCGCGAGCAAGGAAAAGCTTAGCTTGGCTGATATCACCGTTGCCGCTGCCCTGGTCTGGGGTTTC
TCCATGGCTATCGATGCTGAAATGCGCGCAAAGTACCCCTCCGTGGTCGCTTGGTATGAGCGCACTCTCGAGACC
GAGGGCGTCAAGGAGGCCTTTGGTGAGAAGCAATTTATTGAGAAGCGTCAGGATCCCAAGGCTTAG
Transcript >Pro_DTO377G3_2|g916.t1
ATGGCACCATTCGGCACTATCTACTCTTATCAGCCCAGTCCCCGGGTCATGAAGGCCCTGGCCGCGGCCAACCTG
AACGGCCTAGAAGTGGCGGTTCCGGAATTCGCCATGGGCAAGACCAACCGGACCCCGGATTTCCTGTCCAAGTTC
CCTTTGGGTAAAGTGCCCGCCTTCGAGGGTGCCGACGGAACAACCCTATTCGAGTCAGACGCCATCACCCAATAC
ATTGCCGAGAGCGGCCCCGCTGCCGCTCAGCTTACTGGTGCTACCTCCGCCGAGCGCGCTACTATCCGCCAGTGG
ATCTGCTTTGCGCAGGGTGAGATTTTGGACCCTGTGACGCAGTTGGCGCTGCCGCGTCTCGGTATCCGGCCCTTC
GATGAGAAAGTCGAGGAGACCAACCTCGCGCGTCTGGAACGCTCGTTGGAATGTCTCGAGACTCACCTCAAGGGC
CGCACTTGGTTCGCGAGCAAGGAAAAGCTTAGCTTGGCTGATATCACCGTTGCCGCTGCCCTGGTCTGGGGTTTC
TCCATGGCTATCGATGCTGAAATGCGCGCAAAGTACCCCTCCGTGGTCGCTTGGTATGAGCGCACTCTCGAGACC
GAGGGCGTCAAGGAGGCCTTTGGTGAGAAGCAATTTATTGAGAAGCGTCAGGATCCCAAGGCTTAG
Gene >Pro_DTO377G3_2|g916.t1
ATGGCACCATTCGGCACTATCTACTCTTATCAGCCCAGTCCCCGGGTCATGAAGGTACCAATCTCGACCCCCTGT
CAGCATGCAATCACGCGCTAACAACCCCTGCTAGGCCCTGGCCGCGGCCAACCTGAACGGCCTAGAAGTGGCGGT
TCCGGAATTCGCCATGGGCAAGACCAACCGGACCCCGGATTTCCTGTCCAAGTTCCCTTTGGGTAAAGTGCCCGC
CTTCGAGGGTGCCGACGGAACAACCCTATTCGAGTCAGACGCCATCACCCAATACATTGCCGAGAGCGGCCCCGC
TGCCGCTCAGCTTACTGGTGCTACCTCCGCCGAGCGCGCTACTATCCGCCAGTGGATCTGCTTTGCGCAGGGTGA
GATTTTGGACCCTGTGACGCAGTTGGCGCTGCCGCGTCTCGGTATCCGGCCCTTCGATGAGAAAGTCGAGGAGAC
CAACCTCGCGCGTCTGGAACGCTCGTTGGAATGTCTCGAGACTCACCTCAAGGGCCGCACTTGGTTCGCGAGCAA
GGAAAAGCTTAGCTTGGCTGATATCACCGTTGCCGCTGCCCTGGTCTGGGGTTTCTCCATGGCTATCGATGCTGA
AATGCGCGCAAAGTACCCCTCCGTGGTCGCTTGGTATGAGCGCACTCTCGAGACCGAGGGCGTCAAGGAGGCCTT
TGGTGAGAAGCAATTTATTGAGAAGCGTCAGGATCCCAAGGCTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail