Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g9156.t1
Gene name
Locationscaffold_42:121226..122357
Strand-
Gene length (bp)1131
Transcript length (bp)1131
Coding sequence length (bp)1131
Protein length (aa) 377

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03473 MOSC MOSC domain 4.2E-27 213 361
PF03476 MOSC_N MOSC N-terminal beta barrel domain 1.8E-19 47 184

GO

GO Term Description Terminal node
GO:0030170 pyridoxal phosphate binding Yes
GO:0030151 molybdenum ion binding Yes
GO:0003824 catalytic activity Yes
GO:0046914 transition metal ion binding No
GO:0097159 organic cyclic compound binding No
GO:0005488 binding No
GO:0043167 ion binding No
GO:0070279 vitamin B6 binding No
GO:0043169 cation binding No
GO:0019842 vitamin binding No
GO:0046872 metal ion binding No
GO:0043168 anion binding No
GO:1901363 heterocyclic compound binding No
GO:0003674 molecular_function No
GO:0036094 small molecule binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 24 0.45

Transmembrane Domains

Domain # Start End Length
1 2 19 17

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g9156.t1
MVSAVILGLLLLIPIILIPRFKGWPKSVQSPTKLLRLWRQRPKQSSEIVSLRMYPIKSCRGLEVQSTVLKQHGLD
LDRRWMLIDASSNTFLTIRQIPDMTRIRTAISADGDELVVSIPKPEINKPSQYQGQDHHFHTIRIPSHPSPQWLA
ANTNTGPVHIWDTETDGYRYNKEINAPFSAFLRRDVALVYKGPAPRVLKGNGAPRYLGRVQTTGFADVHPVLIAS
EASLAELNVRLVRVGVDPITVERFRPNIVVRGGAPWSEDSWKLVRITGRNASGTFIGSAGSGEAVIQSPLDLDIV
ARCARCQVPNVDPDTALKNKKEPWDTLVSYRRVDEGIRYKPCFGMLSAPRNEGAIEVGMRLEVLEETNEHRYITG
F*
Coding >Pro_DTO377G3_2|g9156.t1
ATGGTGTCAGCAGTGATATTAGGCCTTCTGCTCCTAATTCCAATCATCCTGATTCCGCGCTTCAAAGGATGGCCC
AAATCAGTCCAATCCCCTACCAAACTTCTCCGCCTATGGCGCCAGCGCCCCAAACAATCCAGCGAAATCGTCTCG
CTGCGCATGTACCCCATAAAATCCTGTAGAGGCCTAGAAGTCCAATCAACGGTCCTTAAACAGCATGGTCTTGAC
CTTGACCGCCGCTGGATGCTCATTGACGCATCCTCAAATACGTTTCTAACCATCCGCCAAATCCCCGACATGACC
CGCATTCGCACCGCGATAAGTGCCGACGGCGACGAGTTGGTCGTGAGTATACCGAAACCCGAAATCAACAAACCC
AGCCAATACCAAGGCCAAGACCATCATTTTCATACCATCCGCATCCCTTCCCATCCATCACCGCAATGGCTAGCG
GCAAATACAAATACGGGCCCCGTCCACATCTGGGACACAGAGACAGACGGGTACAGGTACAACAAGGAAATCAAC
GCTCCCTTCTCTGCTTTCCTGCGCCGCGACGTCGCTCTCGTCTACAAGGGCCCGGCTCCGCGCGTGCTGAAGGGT
AACGGCGCCCCCCGCTACCTAGGCCGCGTCCAAACAACCGGCTTTGCGGACGTGCATCCGGTGTTGATTGCGTCG
GAGGCTTCGCTGGCAGAGCTCAATGTTCGTCTGGTAAGGGTGGGCGTCGACCCGATTACTGTCGAGCGGTTCCGT
CCGAATATCGTTGTTCGCGGCGGGGCGCCGTGGAGTGAGGATTCGTGGAAGTTGGTTCGCATTACTGGTCGAAAT
GCTAGCGGTACTTTTATTGGTTCCGCTGGTAGCGGAGAGGCTGTTATTCAGTCTCCGCTTGACCTGGATATTGTG
GCTCGCTGTGCGCGCTGCCAGGTGCCTAATGTTGATCCAGATACGGCGCTCAAGAATAAGAAGGAGCCGTGGGAT
ACACTTGTTTCGTACCGTAGGGTGGATGAGGGGATTAGGTATAAGCCTTGTTTTGGTATGTTGAGTGCGCCGCGT
AATGAGGGGGCTATTGAGGTTGGGATGAGGTTGGAGGTTTTGGAAGAGACGAATGAGCATCGATATATTACTGGC
TTTTAG
Transcript >Pro_DTO377G3_2|g9156.t1
ATGGTGTCAGCAGTGATATTAGGCCTTCTGCTCCTAATTCCAATCATCCTGATTCCGCGCTTCAAAGGATGGCCC
AAATCAGTCCAATCCCCTACCAAACTTCTCCGCCTATGGCGCCAGCGCCCCAAACAATCCAGCGAAATCGTCTCG
CTGCGCATGTACCCCATAAAATCCTGTAGAGGCCTAGAAGTCCAATCAACGGTCCTTAAACAGCATGGTCTTGAC
CTTGACCGCCGCTGGATGCTCATTGACGCATCCTCAAATACGTTTCTAACCATCCGCCAAATCCCCGACATGACC
CGCATTCGCACCGCGATAAGTGCCGACGGCGACGAGTTGGTCGTGAGTATACCGAAACCCGAAATCAACAAACCC
AGCCAATACCAAGGCCAAGACCATCATTTTCATACCATCCGCATCCCTTCCCATCCATCACCGCAATGGCTAGCG
GCAAATACAAATACGGGCCCCGTCCACATCTGGGACACAGAGACAGACGGGTACAGGTACAACAAGGAAATCAAC
GCTCCCTTCTCTGCTTTCCTGCGCCGCGACGTCGCTCTCGTCTACAAGGGCCCGGCTCCGCGCGTGCTGAAGGGT
AACGGCGCCCCCCGCTACCTAGGCCGCGTCCAAACAACCGGCTTTGCGGACGTGCATCCGGTGTTGATTGCGTCG
GAGGCTTCGCTGGCAGAGCTCAATGTTCGTCTGGTAAGGGTGGGCGTCGACCCGATTACTGTCGAGCGGTTCCGT
CCGAATATCGTTGTTCGCGGCGGGGCGCCGTGGAGTGAGGATTCGTGGAAGTTGGTTCGCATTACTGGTCGAAAT
GCTAGCGGTACTTTTATTGGTTCCGCTGGTAGCGGAGAGGCTGTTATTCAGTCTCCGCTTGACCTGGATATTGTG
GCTCGCTGTGCGCGCTGCCAGGTGCCTAATGTTGATCCAGATACGGCGCTCAAGAATAAGAAGGAGCCGTGGGAT
ACACTTGTTTCGTACCGTAGGGTGGATGAGGGGATTAGGTATAAGCCTTGTTTTGGTATGTTGAGTGCGCCGCGT
AATGAGGGGGCTATTGAGGTTGGGATGAGGTTGGAGGTTTTGGAAGAGACGAATGAGCATCGATATATTACTGGC
TTTTAG
Gene >Pro_DTO377G3_2|g9156.t1
ATGGTGTCAGCAGTGATATTAGGCCTTCTGCTCCTAATTCCAATCATCCTGATTCCGCGCTTCAAAGGATGGCCC
AAATCAGTCCAATCCCCTACCAAACTTCTCCGCCTATGGCGCCAGCGCCCCAAACAATCCAGCGAAATCGTCTCG
CTGCGCATGTACCCCATAAAATCCTGTAGAGGCCTAGAAGTCCAATCAACGGTCCTTAAACAGCATGGTCTTGAC
CTTGACCGCCGCTGGATGCTCATTGACGCATCCTCAAATACGTTTCTAACCATCCGCCAAATCCCCGACATGACC
CGCATTCGCACCGCGATAAGTGCCGACGGCGACGAGTTGGTCGTGAGTATACCGAAACCCGAAATCAACAAACCC
AGCCAATACCAAGGCCAAGACCATCATTTTCATACCATCCGCATCCCTTCCCATCCATCACCGCAATGGCTAGCG
GCAAATACAAATACGGGCCCCGTCCACATCTGGGACACAGAGACAGACGGGTACAGGTACAACAAGGAAATCAAC
GCTCCCTTCTCTGCTTTCCTGCGCCGCGACGTCGCTCTCGTCTACAAGGGCCCGGCTCCGCGCGTGCTGAAGGGT
AACGGCGCCCCCCGCTACCTAGGCCGCGTCCAAACAACCGGCTTTGCGGACGTGCATCCGGTGTTGATTGCGTCG
GAGGCTTCGCTGGCAGAGCTCAATGTTCGTCTGGTAAGGGTGGGCGTCGACCCGATTACTGTCGAGCGGTTCCGT
CCGAATATCGTTGTTCGCGGCGGGGCGCCGTGGAGTGAGGATTCGTGGAAGTTGGTTCGCATTACTGGTCGAAAT
GCTAGCGGTACTTTTATTGGTTCCGCTGGTAGCGGAGAGGCTGTTATTCAGTCTCCGCTTGACCTGGATATTGTG
GCTCGCTGTGCGCGCTGCCAGGTGCCTAATGTTGATCCAGATACGGCGCTCAAGAATAAGAAGGAGCCGTGGGAT
ACACTTGTTTCGTACCGTAGGGTGGATGAGGGGATTAGGTATAAGCCTTGTTTTGGTATGTTGAGTGCGCCGCGT
AATGAGGGGGCTATTGAGGTTGGGATGAGGTTGGAGGTTTTGGAAGAGACGAATGAGCATCGATATATTACTGGC
TTTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail