Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g915.t1
Gene name
Locationscaffold_01:2424748..2427059
Strand+
Gene length (bp)2311
Transcript length (bp)2259
Coding sequence length (bp)2259
Protein length (aa) 753

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00732 GMC_oxred_N GMC oxidoreductase 7.3E-49 223 496
PF05199 GMC_oxred_C GMC oxidoreductase 1.1E-28 579 729
PF00890 FAD_binding_2 FAD binding domain 2.5E-06 223 256
PF01494 FAD_binding_3 FAD binding domain 1.8E-05 221 254

GO

GO Term Description Terminal node
GO:0016614 oxidoreductase activity, acting on CH-OH group of donors Yes
GO:0050660 flavin adenine dinucleotide binding Yes
GO:0071949 FAD binding Yes
GO:1901265 nucleoside phosphate binding No
GO:0016491 oxidoreductase activity No
GO:0097159 organic cyclic compound binding No
GO:0005488 binding No
GO:0043167 ion binding No
GO:0000166 nucleotide binding No
GO:0043168 anion binding No
GO:1901363 heterocyclic compound binding No
GO:0003674 molecular_function No
GO:0003824 catalytic activity No
GO:0036094 small molecule binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 49 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 33.16 19.95 46.37
5d_25C Five days - 25 degrees Celsius 38.32 23.34 53.29
7d_25C Seven days - 25 degrees Celsius 42.45 25.87 59.02
10d_25C Ten days - 25 degrees Celsius 45.47 27.71 63.23
7d_15C Seven days - 15 degrees Celsius 31.59 19.01 44.18
7d_30C Seven days - 30 degrees Celsius 41.42 25.16 57.67

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.598775 no
3d_25C 7d_25C 0.305440 no
3d_25C 7d_15C 0.887918 no
3d_25C 7d_30C 0.374184 no
3d_25C 10d_25C 0.167878 no
5d_25C 7d_25C 0.725716 no
5d_25C 7d_15C 0.450309 no
5d_25C 7d_30C 0.799859 no
5d_25C 10d_25C 0.509886 no
7d_25C 7d_15C 0.198175 no
7d_25C 7d_30C 0.943709 no
7d_25C 10d_25C 0.821908 no
7d_15C 7d_30C 0.257440 no
7d_15C 10d_25C 0.104886 no
7d_30C 10d_25C 0.750738 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g915.t1
MPTLAVSTYTPRDVPLPPAPSATYFSELQWKTFYALADAVVPSIHTAATTKSSNDRVISNAEWNSAVSSLSTAIS
GPDAVNLATQYLQENVSSNPQFRAAVERLLGDYVNDEGRNGFGFIMSALNTRAGSLVMTGSTTPIQDQPIEFREK
ILRGWDTSRLAPLRAIYRGLTAIVKKCWVISSPTISPVLGFPSIPIHGEQVDGFQFEFLQFPSGDQPETIETDVV
IVGSGCGGSVAAKNLAEAGYRVLVVEKSYSYPTNTFPMGANEGYTNMFENGGAVSSDDGSMAVLAGSTWGGGGTV
NWSAALQTQGYVRQQWADTGLPFFTSLDFQKSLDRVCDRMGVNDDHVEHNYQNKVVIEGARKLGYAVKTVPQNTG
HGEHYCGYCTLGCASGGKKGPTESFLVDAAQAGAKFIEGFRADKVLFTTVKGKKVASGVQGTWKSRDSYLGLAGI
GAVERRLIIKAKKVVVSAGTLQSPLLLLRSGLKNPQIGRNLHLHPVLAASAVFDEDTHPWEGSALTTVVTEFEDL
DGNGHGAKIETAAMLPSVVIPIFPWRDSLEYKMWAAKMRHSTSFIVLTKERDTGRVYPDPVDGRCRIDYTVSAFD
RKHMVETLIGIAKIAYISGAKEFHTVYRDLPPFIRPETSDPEAPEGINNTALQSWIAELRAKSPLNPERGLFASA
HQMGTCRMSKSPKLGVVDPNCQVWGTDGLYVVDASVFPSASGVNPMVTNMGIADWASRNLARAMGTVPGEGNVMA
RL*
Coding >Pro_DTO377G3_2|g915.t1
ATGCCAACCCTCGCTGTTTCCACATACACCCCGAGGGATGTCCCTCTTCCGCCAGCGCCGTCGGCCACTTACTTC
TCGGAGTTGCAGTGGAAAACCTTCTATGCGCTGGCCGACGCAGTTGTGCCCTCTATCCACACTGCAGCAACTACC
AAGTCATCGAACGACCGGGTGATTTCAAATGCAGAGTGGAATTCCGCCGTGTCGAGCTTGTCAACGGCTATCTCT
GGACCTGACGCCGTAAACCTTGCCACCCAGTACCTGCAAGAAAATGTCTCTTCGAACCCGCAATTCCGGGCCGCA
GTGGAGCGACTCCTGGGCGACTATGTGAATGACGAGGGAAGAAATGGGTTTGGTTTCATCATGTCAGCGCTCAAC
ACCCGTGCTGGTTCTCTGGTCATGACGGGCTCCACCACTCCGATCCAGGACCAACCGATTGAATTCCGAGAAAAG
ATCTTGCGCGGATGGGACACCTCTCGATTGGCTCCTCTCCGCGCCATCTACCGAGGACTCACGGCCATTGTTAAG
AAGTGTTGGGTTATCAGCAGTCCAACCATAAGCCCGGTTCTGGGGTTCCCAAGCATCCCTATTCATGGCGAGCAG
GTCGACGGTTTCCAGTTTGAGTTTTTGCAGTTCCCTTCTGGGGATCAGCCAGAAACGATTGAAACCGACGTCGTT
ATCGTGGGAAGTGGCTGCGGCGGTAGCGTGGCTGCAAAGAACCTCGCCGAAGCGGGCTATCGAGTGCTGGTGGTG
GAAAAGTCCTATTCATACCCGACCAACACGTTCCCCATGGGCGCGAATGAGGGATATACCAACATGTTCGAGAAC
GGGGGCGCTGTCTCCAGTGACGATGGCTCGATGGCGGTCCTAGCGGGCTCAACGTGGGGTGGTGGTGGTACCGTG
AATTGGTCGGCCGCTTTACAGACCCAGGGGTATGTCCGACAGCAATGGGCGGATACTGGTCTCCCTTTCTTCACC
TCCCTCGACTTCCAGAAAAGCTTGGACCGCGTCTGTGATCGCATGGGTGTTAACGACGATCATGTTGAGCATAAC
TACCAGAATAAGGTGGTTATTGAAGGCGCAAGGAAACTGGGATATGCCGTGAAAACAGTTCCCCAGAATACAGGT
CACGGCGAACACTACTGTGGGTATTGCACGTTAGGATGCGCGTCGGGTGGGAAGAAAGGCCCAACGGAGTCGTTC
CTTGTGGATGCTGCTCAGGCCGGCGCAAAATTCATCGAAGGATTCCGTGCCGACAAAGTGCTATTCACCACCGTC
AAAGGCAAAAAGGTTGCTTCTGGCGTACAAGGAACTTGGAAGTCACGGGATTCATACTTGGGCCTCGCTGGTATT
GGGGCTGTGGAACGTCGGCTGATTATCAAGGCTAAGAAAGTAGTTGTATCAGCTGGCACATTGCAAAGTCCTCTT
CTGCTGTTGCGTAGTGGTTTGAAGAATCCTCAGATTGGCCGAAACCTTCATCTTCACCCTGTGCTTGCGGCTAGT
GCTGTCTTTGATGAGGATACTCACCCCTGGGAAGGCTCTGCGTTGACAACGGTTGTCACCGAGTTTGAGGACCTT
GATGGAAATGGACATGGTGCGAAGATTGAGACTGCCGCAATGTTGCCTTCCGTGGTCATTCCTATCTTCCCCTGG
CGAGACTCATTGGAGTATAAGATGTGGGCGGCCAAGATGCGTCACAGCACGAGCTTCATCGTCTTAACCAAAGAA
CGCGATACTGGTCGTGTCTACCCAGATCCGGTCGATGGACGCTGCCGGATTGATTACACGGTATCTGCCTTTGAC
CGGAAACACATGGTGGAGACCCTGATTGGCATCGCCAAGATTGCGTATATCTCAGGAGCCAAAGAGTTCCATACT
GTTTACCGCGACCTTCCCCCCTTCATCCGGCCAGAGACTTCAGACCCCGAGGCCCCTGAAGGCATTAACAATACG
GCTCTGCAGAGTTGGATTGCCGAGCTTCGTGCGAAGTCCCCTTTGAACCCGGAGCGTGGTTTGTTTGCCAGTGCA
CACCAGATGGGTACCTGCCGCATGAGCAAGTCACCTAAATTAGGTGTGGTGGACCCGAATTGTCAAGTCTGGGGC
ACTGACGGGTTGTATGTCGTGGATGCGTCCGTGTTCCCTAGCGCCAGCGGTGTGAATCCGATGGTCACTAATATG
GGTATCGCCGATTGGGCCAGCCGAAACCTCGCGCGGGCGATGGGAACGGTACCAGGCGAGGGCAACGTGATGGCT
CGTCTGTGA
Transcript >Pro_DTO377G3_2|g915.t1
ATGCCAACCCTCGCTGTTTCCACATACACCCCGAGGGATGTCCCTCTTCCGCCAGCGCCGTCGGCCACTTACTTC
TCGGAGTTGCAGTGGAAAACCTTCTATGCGCTGGCCGACGCAGTTGTGCCCTCTATCCACACTGCAGCAACTACC
AAGTCATCGAACGACCGGGTGATTTCAAATGCAGAGTGGAATTCCGCCGTGTCGAGCTTGTCAACGGCTATCTCT
GGACCTGACGCCGTAAACCTTGCCACCCAGTACCTGCAAGAAAATGTCTCTTCGAACCCGCAATTCCGGGCCGCA
GTGGAGCGACTCCTGGGCGACTATGTGAATGACGAGGGAAGAAATGGGTTTGGTTTCATCATGTCAGCGCTCAAC
ACCCGTGCTGGTTCTCTGGTCATGACGGGCTCCACCACTCCGATCCAGGACCAACCGATTGAATTCCGAGAAAAG
ATCTTGCGCGGATGGGACACCTCTCGATTGGCTCCTCTCCGCGCCATCTACCGAGGACTCACGGCCATTGTTAAG
AAGTGTTGGGTTATCAGCAGTCCAACCATAAGCCCGGTTCTGGGGTTCCCAAGCATCCCTATTCATGGCGAGCAG
GTCGACGGTTTCCAGTTTGAGTTTTTGCAGTTCCCTTCTGGGGATCAGCCAGAAACGATTGAAACCGACGTCGTT
ATCGTGGGAAGTGGCTGCGGCGGTAGCGTGGCTGCAAAGAACCTCGCCGAAGCGGGCTATCGAGTGCTGGTGGTG
GAAAAGTCCTATTCATACCCGACCAACACGTTCCCCATGGGCGCGAATGAGGGATATACCAACATGTTCGAGAAC
GGGGGCGCTGTCTCCAGTGACGATGGCTCGATGGCGGTCCTAGCGGGCTCAACGTGGGGTGGTGGTGGTACCGTG
AATTGGTCGGCCGCTTTACAGACCCAGGGGTATGTCCGACAGCAATGGGCGGATACTGGTCTCCCTTTCTTCACC
TCCCTCGACTTCCAGAAAAGCTTGGACCGCGTCTGTGATCGCATGGGTGTTAACGACGATCATGTTGAGCATAAC
TACCAGAATAAGGTGGTTATTGAAGGCGCAAGGAAACTGGGATATGCCGTGAAAACAGTTCCCCAGAATACAGGT
CACGGCGAACACTACTGTGGGTATTGCACGTTAGGATGCGCGTCGGGTGGGAAGAAAGGCCCAACGGAGTCGTTC
CTTGTGGATGCTGCTCAGGCCGGCGCAAAATTCATCGAAGGATTCCGTGCCGACAAAGTGCTATTCACCACCGTC
AAAGGCAAAAAGGTTGCTTCTGGCGTACAAGGAACTTGGAAGTCACGGGATTCATACTTGGGCCTCGCTGGTATT
GGGGCTGTGGAACGTCGGCTGATTATCAAGGCTAAGAAAGTAGTTGTATCAGCTGGCACATTGCAAAGTCCTCTT
CTGCTGTTGCGTAGTGGTTTGAAGAATCCTCAGATTGGCCGAAACCTTCATCTTCACCCTGTGCTTGCGGCTAGT
GCTGTCTTTGATGAGGATACTCACCCCTGGGAAGGCTCTGCGTTGACAACGGTTGTCACCGAGTTTGAGGACCTT
GATGGAAATGGACATGGTGCGAAGATTGAGACTGCCGCAATGTTGCCTTCCGTGGTCATTCCTATCTTCCCCTGG
CGAGACTCATTGGAGTATAAGATGTGGGCGGCCAAGATGCGTCACAGCACGAGCTTCATCGTCTTAACCAAAGAA
CGCGATACTGGTCGTGTCTACCCAGATCCGGTCGATGGACGCTGCCGGATTGATTACACGGTATCTGCCTTTGAC
CGGAAACACATGGTGGAGACCCTGATTGGCATCGCCAAGATTGCGTATATCTCAGGAGCCAAAGAGTTCCATACT
GTTTACCGCGACCTTCCCCCCTTCATCCGGCCAGAGACTTCAGACCCCGAGGCCCCTGAAGGCATTAACAATACG
GCTCTGCAGAGTTGGATTGCCGAGCTTCGTGCGAAGTCCCCTTTGAACCCGGAGCGTGGTTTGTTTGCCAGTGCA
CACCAGATGGGTACCTGCCGCATGAGCAAGTCACCTAAATTAGGTGTGGTGGACCCGAATTGTCAAGTCTGGGGC
ACTGACGGGTTGTATGTCGTGGATGCGTCCGTGTTCCCTAGCGCCAGCGGTGTGAATCCGATGGTCACTAATATG
GGTATCGCCGATTGGGCCAGCCGAAACCTCGCGCGGGCGATGGGAACGGTACCAGGCGAGGGCAACGTGATGGCT
CGTCTGTGA
Gene >Pro_DTO377G3_2|g915.t1
ATGCCAACCCTCGCTGTTTCCACATACACCCCGAGGGATGTCCCTCTTCCGCCAGCGCCGTCGGCCACTTACTTC
TCGGAGTTGCAGTGGAAAACCTTCTATGCGCTGGCCGACGCAGTTGTGCCCTCTATCCACACTGCAGCAACTACC
AAGTCATCGAACGACCGGGTGATTTCAAATGCAGAGTGGAATTCCGCCGTGTCGAGCTTGTCAACGGCTATCTCT
GGACCTGACGCCGTAAACCTTGCCACCCAGTACCTGCAAGAAAATGTCTCTTCGAACCCGCAATTCCGGGCCGCA
GTGGAGCGACTCCTGGGCGACTATGTGAATGACGAGGGAAGAAATGGGTTTGGTTTCATCATGTCAGCGCTCAAC
ACCCGTGCTGGTTCTCTGGTCATGACGGGCTCCACCACTCCGATCCAGGACCAACCGATTGAATTCCGAGAAAAG
ATCTTGCGCGGATGGGACACCTCTCGATTGGCTCCTCTCCGCGCCATCTACCGAGGACTCACGGCCATTGTTAAG
AAGTGTTGGGTTATCAGCAGTCCAACCATAAGCCCGGTTCTGGGGTTCCCAAGCATCCCTATTCATGGCGAGCAG
GTCGACGGTTTCCAGTTTGAGTTTTTGCAGTTCCCTTCTGGGGATCAGCCAGAAACGATTGAAACCGACGTCGTT
ATCGTGGGAAGTGGCTGCGGCGGTAGCGTGGCTGCAAAGAACCTCGCCGAAGCGGGCTATCGAGTGCTGGTGGTG
GAAAAGTCCTATTCATACCCGACCAACACGTTCCCCATGGGCGCGAATGAGGGATATACCAACATGTTCGAGAAC
GGGGGCGCTGTCTCCAGTGACGATGGCTCGATGGCGGTCCTAGCGGGCTCAACGTGGGGTGGTGGTGGTACCGTG
AATTGGTCGGCCGCTTTACAGACCCAGGGGTATGTCCGACAGCAATGGGCGGATACTGGTCTCCCTTTCTTCACC
TCCCTCGACTTCCAGAAAAGCTTGGACCGCGTCTGTGATCGCATGGGTGTTAACGACGATCATGTTGAGCATAAC
TACCAGAATAAGGTGGTTATTGAAGGCGCAAGGAAACTGGGATATGCCGTGAAAACAGTTCCCCAGAATACAGGT
CACGGCGAACACTACTGTGGGTATTGCACGTTAGGATGCGCGTCGGGTGGGAAGAAAGGCCCAACGGAGTCGTTC
CTTGTGGATGCTGCTCAGGCCGGCGCAAAATTCATCGAAGGATTCCGTGCCGACAAAGTGCTATTCACCACCGTC
AAAGGCAAAAAGGTTGCTTCTGGCGTACAAGGAACTTGGAAGTCACGGGATTCATACTTGGGCCTCGCTGGTATT
GGGGCTGTGGAACGTCGGCTGATTATCAAGGCTAAGAAAGTAGTTGTATCAGCTGGCACATTGCAAAGTCCTCTT
CTGCTGTTGCGTAGTGGTTTGAAGAATCCTCAGATTGGCCGAAACCTTCATCTTCACCCTGGTAAGAACTTTCTT
TCACAGCACATTTTACAGGCACTTATTTTCTTCTACAGTGCTTGCGGCTAGTGCTGTCTTTGATGAGGATACTCA
CCCCTGGGAAGGCTCTGCGTTGACAACGGTTGTCACCGAGTTTGAGGACCTTGATGGAAATGGACATGGTGCGAA
GATTGAGACTGCCGCAATGTTGCCTTCCGTGGTCATTCCTATCTTCCCCTGGCGAGACTCATTGGAGTATAAGAT
GTGGGCGGCCAAGATGCGTCACAGCACGAGCTTCATCGTCTTAACCAAAGAACGCGATACTGGTCGTGTCTACCC
AGATCCGGTCGATGGACGCTGCCGGATTGATTACACGGTATCTGCCTTTGACCGGAAACACATGGTGGAGACCCT
GATTGGCATCGCCAAGATTGCGTATATCTCAGGAGCCAAAGAGTTCCATACTGTTTACCGCGACCTTCCCCCCTT
CATCCGGCCAGAGACTTCAGACCCCGAGGCCCCTGAAGGCATTAACAATACGGCTCTGCAGAGTTGGATTGCCGA
GCTTCGTGCGAAGTCCCCTTTGAACCCGGAGCGTGGTTTGTTTGCCAGTGCACACCAGATGGGTACCTGCCGCAT
GAGCAAGTCACCTAAATTAGGTGTGGTGGACCCGAATTGTCAAGTCTGGGGCACTGACGGGTTGTATGTCGTGGA
TGCGTCCGTGTTCCCTAGCGCCAGCGGTGTGAATCCGATGGTCACTAATATGGGTATCGCCGATTGGGCCAGCCG
AAACCTCGCGCGGGCGATGGGAACGGTACCAGGCGAGGGCAACGTGATGGCTCGTCTGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail