Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g9142.t1
Gene name
Locationscaffold_42:77648..79334
Strand+
Gene length (bp)1686
Transcript length (bp)1629
Coding sequence length (bp)1629
Protein length (aa) 543

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00732 GMC_oxred_N GMC oxidoreductase 3.3E-52 15 307
PF05199 GMC_oxred_C GMC oxidoreductase 2.0E-38 384 525

GO

GO Term Description Terminal node
GO:0016614 oxidoreductase activity, acting on CH-OH group of donors Yes
GO:0050660 flavin adenine dinucleotide binding Yes
GO:1901265 nucleoside phosphate binding No
GO:0016491 oxidoreductase activity No
GO:0097159 organic cyclic compound binding No
GO:0005488 binding No
GO:0043167 ion binding No
GO:0000166 nucleotide binding No
GO:0043168 anion binding No
GO:1901363 heterocyclic compound binding No
GO:0003674 molecular_function No
GO:0003824 catalytic activity No
GO:0036094 small molecule binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 31 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 63.47 38.60 88.35
5d_25C Five days - 25 degrees Celsius 77.17 47.01 107.32
7d_25C Seven days - 25 degrees Celsius 72.22 43.98 100.45
10d_25C Ten days - 25 degrees Celsius 86.56 53.08 120.04
7d_15C Seven days - 15 degrees Celsius 76.61 46.98 106.24
7d_30C Seven days - 30 degrees Celsius 74.45 45.37 103.54

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.435346 no
3d_25C 7d_25C 0.636610 no
3d_25C 7d_15C 0.443940 no
3d_25C 7d_30C 0.541961 no
3d_25C 10d_25C 0.152313 no
5d_25C 7d_25C 0.832546 no
5d_25C 7d_15C 0.983657 no
5d_25C 7d_30C 0.915278 no
5d_25C 10d_25C 0.677784 no
7d_25C 7d_15C 0.851799 no
7d_25C 7d_30C 0.931534 no
7d_25C 10d_25C 0.461387 no
7d_15C 7d_30C 0.931904 no
7d_15C 10d_25C 0.645394 no
7d_30C 10d_25C 0.560586 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g9142.t1
MATTNELLAADVNSYDYIVVGGGTAGCVIAARLAEYLPNKRTLVIEGGPSDFMDDRVLNLKEWLSLLGGELDYDY
GTTEQPMGNSNIRHSRAKVLGGCSSHNTLISFRPFEYDCRQWVSKGCKGWDFETFTRIIDNLRNTIQPVHARHRN
QLCKDWIQACSSAMNIPVIENFNDDIRKTGELTEGVGFFNISYNPDDGRRSSASVAYIHPILRGDEKRPNLTILT
NAWVNKINIEGDTVTGVDVTLQSGVKHTLRAQKETILCAGAVDTPRLMLLSGLGPREQLSALGIPVVKDIPGVGE
NLLDHPESIIMWELNSPVDHNMTTMDSDAGIFLRRELPDAAGFDGKIADVMMHCYQIPFTLNTTRLGYDEPLNAF
CMTPNIPRPRSRGRIFLTSADPSVKPSLDFRYFTDPEGYDAATIVAGLKAAREIAKQSPFKEWIKREVAPGPKVQ
TDEELSEYGRRVAHTVYHPAGTTKMGNVLTDPMAVVDPTLKVRGLKGIRIADAGVFPDMPSINPMLTVLAIGERA
AELIAGEAGWSRNQPRL*
Coding >Pro_DTO377G3_2|g9142.t1
ATGGCCACCACTAACGAGCTCCTCGCCGCCGATGTTAACAGCTACGACTACATCGTCGTTGGCGGCGGTACCGCC
GGCTGTGTGATTGCGGCTCGTCTGGCCGAGTACCTCCCGAACAAGCGCACTCTGGTTATTGAGGGAGGTCCTAGT
GATTTCATGGATGATCGCGTTCTGAACTTGAAGGAATGGCTCAGTCTGCTCGGAGGCGAGCTTGACTACGACTAC
GGTACTACTGAGCAACCAATGGGTAACAGTAATATCCGTCACTCCCGTGCAAAGGTCCTGGGTGGTTGCTCTAGC
CACAACACTCTCATCTCTTTCCGTCCCTTCGAGTATGATTGCCGTCAATGGGTGTCCAAAGGATGTAAGGGCTGG
GACTTTGAGACCTTTACCCGCATAATTGATAACCTGCGCAACACCATCCAGCCGGTGCATGCCCGCCACCGTAAC
CAGCTGTGCAAGGACTGGATCCAGGCCTGCTCTAGCGCTATGAACATCCCCGTCATTGAGAACTTCAACGATGAC
ATCCGCAAGACCGGTGAGCTGACTGAGGGTGTCGGCTTCTTTAACATCTCCTACAACCCCGATGACGGCCGCCGC
AGCAGCGCCAGTGTCGCTTATATCCACCCCATTCTCCGTGGGGATGAGAAGCGTCCTAACTTGACCATTCTCACC
AACGCTTGGGTTAACAAGATCAACATTGAGGGTGATACCGTGACCGGCGTTGATGTTACTCTCCAGTCTGGTGTC
AAGCACACTCTACGTGCCCAGAAGGAGACCATTCTGTGTGCCGGGGCTGTCGACACCCCTCGTCTGATGCTGCTC
TCCGGTCTTGGTCCGCGTGAGCAGCTGTCCGCACTCGGCATTCCCGTCGTGAAGGATATTCCCGGTGTTGGTGAG
AACCTGCTAGACCACCCCGAGAGCATCATCATGTGGGAGCTCAACAGCCCCGTGGATCACAACATGACCACCATG
GACTCTGATGCCGGTATCTTCTTGCGCCGCGAGCTGCCCGACGCCGCCGGATTCGACGGCAAGATCGCCGACGTG
ATGATGCACTGCTACCAGATTCCGTTCACCCTGAACACCACTCGCCTCGGTTACGACGAGCCCCTGAACGCCTTC
TGCATGACCCCCAACATTCCCCGTCCCCGCTCCCGTGGTCGTATCTTCTTGACCTCCGCCGATCCCTCCGTGAAG
CCCTCGTTGGACTTCCGCTACTTCACCGACCCCGAGGGCTACGATGCCGCCACCATCGTGGCAGGCCTCAAGGCC
GCTCGTGAGATTGCCAAGCAGTCCCCCTTCAAGGAGTGGATCAAGCGTGAGGTTGCCCCCGGCCCCAAGGTGCAG
ACTGATGAAGAGCTGTCCGAGTACGGCCGTCGTGTCGCCCACACCGTGTACCATCCCGCTGGTACTACCAAGATG
GGTAACGTTCTCACCGACCCCATGGCGGTTGTAGACCCCACACTGAAGGTCCGCGGCCTGAAGGGCATCCGTATC
GCCGATGCCGGTGTCTTCCCTGACATGCCTAGCATCAATCCTATGTTGACGGTCCTGGCCATTGGTGAACGTGCC
GCCGAGCTGATTGCTGGCGAGGCCGGTTGGTCCCGCAACCAGCCTCGTCTGTAA
Transcript >Pro_DTO377G3_2|g9142.t1
ATGGCCACCACTAACGAGCTCCTCGCCGCCGATGTTAACAGCTACGACTACATCGTCGTTGGCGGCGGTACCGCC
GGCTGTGTGATTGCGGCTCGTCTGGCCGAGTACCTCCCGAACAAGCGCACTCTGGTTATTGAGGGAGGTCCTAGT
GATTTCATGGATGATCGCGTTCTGAACTTGAAGGAATGGCTCAGTCTGCTCGGAGGCGAGCTTGACTACGACTAC
GGTACTACTGAGCAACCAATGGGTAACAGTAATATCCGTCACTCCCGTGCAAAGGTCCTGGGTGGTTGCTCTAGC
CACAACACTCTCATCTCTTTCCGTCCCTTCGAGTATGATTGCCGTCAATGGGTGTCCAAAGGATGTAAGGGCTGG
GACTTTGAGACCTTTACCCGCATAATTGATAACCTGCGCAACACCATCCAGCCGGTGCATGCCCGCCACCGTAAC
CAGCTGTGCAAGGACTGGATCCAGGCCTGCTCTAGCGCTATGAACATCCCCGTCATTGAGAACTTCAACGATGAC
ATCCGCAAGACCGGTGAGCTGACTGAGGGTGTCGGCTTCTTTAACATCTCCTACAACCCCGATGACGGCCGCCGC
AGCAGCGCCAGTGTCGCTTATATCCACCCCATTCTCCGTGGGGATGAGAAGCGTCCTAACTTGACCATTCTCACC
AACGCTTGGGTTAACAAGATCAACATTGAGGGTGATACCGTGACCGGCGTTGATGTTACTCTCCAGTCTGGTGTC
AAGCACACTCTACGTGCCCAGAAGGAGACCATTCTGTGTGCCGGGGCTGTCGACACCCCTCGTCTGATGCTGCTC
TCCGGTCTTGGTCCGCGTGAGCAGCTGTCCGCACTCGGCATTCCCGTCGTGAAGGATATTCCCGGTGTTGGTGAG
AACCTGCTAGACCACCCCGAGAGCATCATCATGTGGGAGCTCAACAGCCCCGTGGATCACAACATGACCACCATG
GACTCTGATGCCGGTATCTTCTTGCGCCGCGAGCTGCCCGACGCCGCCGGATTCGACGGCAAGATCGCCGACGTG
ATGATGCACTGCTACCAGATTCCGTTCACCCTGAACACCACTCGCCTCGGTTACGACGAGCCCCTGAACGCCTTC
TGCATGACCCCCAACATTCCCCGTCCCCGCTCCCGTGGTCGTATCTTCTTGACCTCCGCCGATCCCTCCGTGAAG
CCCTCGTTGGACTTCCGCTACTTCACCGACCCCGAGGGCTACGATGCCGCCACCATCGTGGCAGGCCTCAAGGCC
GCTCGTGAGATTGCCAAGCAGTCCCCCTTCAAGGAGTGGATCAAGCGTGAGGTTGCCCCCGGCCCCAAGGTGCAG
ACTGATGAAGAGCTGTCCGAGTACGGCCGTCGTGTCGCCCACACCGTGTACCATCCCGCTGGTACTACCAAGATG
GGTAACGTTCTCACCGACCCCATGGCGGTTGTAGACCCCACACTGAAGGTCCGCGGCCTGAAGGGCATCCGTATC
GCCGATGCCGGTGTCTTCCCTGACATGCCTAGCATCAATCCTATGTTGACGGTCCTGGCCATTGGTGAACGTGCC
GCCGAGCTGATTGCTGGCGAGGCCGGTTGGTCCCGCAACCAGCCTCGTCTGTAA
Gene >Pro_DTO377G3_2|g9142.t1
ATGGCCACCACTAACGAGCTCCTCGCCGCCGATGTTAACAGCTACGACTACATCGTCGTTGGCGGCGGTACCGCC
GGCTGTGTGATTGCGGCTCGTCTGGCCGAGTACCTCCCGAACAAGCGCACTCTGGTTATTGAGGGAGGTCCTAGT
GATTTCATGGATGATCGCGTTCTGAACTTGAAGGAATGGCTCAGTCTGCTCGGAGGCGAGCTTGACTACGACTAC
GGTACTACTGAGCAACCAATGGGTAAGAAACTTATCTTTTCTAAATTTCTAAAAGAGCTTATGCTGACTATCCCC
GAAGGTAACAGTAATATCCGTCACTCCCGTGCAAAGGTCCTGGGTGGTTGCTCTAGCCACAACACTCTCATCTCT
TTCCGTCCCTTCGAGTATGATTGCCGTCAATGGGTGTCCAAAGGATGTAAGGGCTGGGACTTTGAGACCTTTACC
CGCATAATTGATAACCTGCGCAACACCATCCAGCCGGTGCATGCCCGCCACCGTAACCAGCTGTGCAAGGACTGG
ATCCAGGCCTGCTCTAGCGCTATGAACATCCCCGTCATTGAGAACTTCAACGATGACATCCGCAAGACCGGTGAG
CTGACTGAGGGTGTCGGCTTCTTTAACATCTCCTACAACCCCGATGACGGCCGCCGCAGCAGCGCCAGTGTCGCT
TATATCCACCCCATTCTCCGTGGGGATGAGAAGCGTCCTAACTTGACCATTCTCACCAACGCTTGGGTTAACAAG
ATCAACATTGAGGGTGATACCGTGACCGGCGTTGATGTTACTCTCCAGTCTGGTGTCAAGCACACTCTACGTGCC
CAGAAGGAGACCATTCTGTGTGCCGGGGCTGTCGACACCCCTCGTCTGATGCTGCTCTCCGGTCTTGGTCCGCGT
GAGCAGCTGTCCGCACTCGGCATTCCCGTCGTGAAGGATATTCCCGGTGTTGGTGAGAACCTGCTAGACCACCCC
GAGAGCATCATCATGTGGGAGCTCAACAGCCCCGTGGATCACAACATGACCACCATGGACTCTGATGCCGGTATC
TTCTTGCGCCGCGAGCTGCCCGACGCCGCCGGATTCGACGGCAAGATCGCCGACGTGATGATGCACTGCTACCAG
ATTCCGTTCACCCTGAACACCACTCGCCTCGGTTACGACGAGCCCCTGAACGCCTTCTGCATGACCCCCAACATT
CCCCGTCCCCGCTCCCGTGGTCGTATCTTCTTGACCTCCGCCGATCCCTCCGTGAAGCCCTCGTTGGACTTCCGC
TACTTCACCGACCCCGAGGGCTACGATGCCGCCACCATCGTGGCAGGCCTCAAGGCCGCTCGTGAGATTGCCAAG
CAGTCCCCCTTCAAGGAGTGGATCAAGCGTGAGGTTGCCCCCGGCCCCAAGGTGCAGACTGATGAAGAGCTGTCC
GAGTACGGCCGTCGTGTCGCCCACACCGTGTACCATCCCGCTGGTACTACCAAGATGGGTAACGTTCTCACCGAC
CCCATGGCGGTTGTAGACCCCACACTGAAGGTCCGCGGCCTGAAGGGCATCCGTATCGCCGATGCCGGTGTCTTC
CCTGACATGCCTAGCATCAATCCTATGTTGACGGTCCTGGCCATTGGTGAACGTGCCGCCGAGCTGATTGCTGGC
GAGGCCGGTTGGTCCCGCAACCAGCCTCGTCTGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail