Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g9139.t1
Gene name
Locationscaffold_42:69382..72482
Strand-
Gene length (bp)3100
Transcript length (bp)2793
Coding sequence length (bp)2793
Protein length (aa) 931

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00933 Glyco_hydro_3 Glycosyl hydrolase family 3 N terminal domain 1.3E-65 15 341

GO

GO Term Description Terminal node
GO:0004553 hydrolase activity, hydrolyzing O-glycosyl compounds Yes
GO:0005975 carbohydrate metabolic process Yes
GO:0016798 hydrolase activity, acting on glycosyl bonds No
GO:0008150 biological_process No
GO:0044238 primary metabolic process No
GO:0008152 metabolic process No
GO:0003674 molecular_function No
GO:0003824 catalytic activity No
GO:0016787 hydrolase activity No
GO:0071704 organic substance metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 35 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 35.97 21.85 50.08
5d_25C Five days - 25 degrees Celsius 24.69 14.72 34.66
7d_25C Seven days - 25 degrees Celsius 23.82 14.10 33.54
10d_25C Ten days - 25 degrees Celsius 15.43 8.67 22.19
7d_15C Seven days - 15 degrees Celsius 28.23 16.99 39.47
7d_30C Seven days - 30 degrees Celsius 19.70 11.48 27.92

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.083660 no
3d_25C 7d_25C 0.063161 no
3d_25C 7d_15C 0.324525 no
3d_25C 7d_30C 0.004840 yes
3d_25C 10d_25C 0.000700 yes
5d_25C 7d_25C 0.918044 no
5d_25C 7d_15C 0.632252 no
5d_25C 7d_30C 0.374467 no
5d_25C 10d_25C 0.037576 yes
7d_25C 7d_15C 0.529566 no
7d_25C 7d_30C 0.481809 no
7d_25C 10d_25C 0.060739 no
7d_15C 7d_30C 0.112289 no
7d_15C 10d_25C 0.005235 yes
7d_30C 10d_25C 0.359339 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g9139.t1
MARKEGMLSPGWEDLDRQMGQLFMMGFDGTEVNPQIRSLIENYHLGTVMLSAKNLKSAEDATRLVLELQTIARDA
GHPVPLLIALDQENGGVNSLYDEIYIRQFPSTMGIAATGSKSLAHEVAVATAQELKAVGVNWILGPVLDVLTNVR
NQPLGVRTAGDDPQEASQYGVQFMKGYQEAGLVTCGKHFPSYGNLEFLGSPTDVPIITESLEQLSLNALVPFRNA
INQGLDAMIVGGVSLSSAGMNVMHACLSDQVVNELLRKDLQFQGVVVSECLEMEALTHNIGVGGGTVMAKNAGCD
VMLLCRSFPVQQEAINGLKLGVENGIISRQRVEQSLRRVLDLKARCTSWEQALNPPGLSSLTQMQPSHTNLSTRA
YNSSITVMRDKNNLLPLSNVIEPDEELLLLTPLVKPLPTSAVSLSVAESARGSLDPLCSERTSSILSGEGVFKEL
GRSLSRQRNGRVLHTSYTSNGVRPIHDDLIQRASAVVVVTADANRNLYQQGFSKHVAMICQSQYTPSGERRAKPL
IVVAVSSPYDFAMDSSIGTYICTYDFTETALQALVKVLYGDLTPSAALPGSIGRTQKIHQSRQHWLVENWNEDRD
SFALDALLDTIRVDCTLGQPSELLGATASSFLLRKEDIDEAHFVVRNSSTHALYGFCATYFFRSTGTGVIACLIV
DPSRRKLSIGHSLHSRAIRTLLQRTGMKRFQLGSRLPGIYLGIPTVNPVERKRLRQWFANMGWNTALSRPVCSVI
MRNLSTWVPPEGLTATLQNAEVTYDLVYGWDFAPAILDHIKTYARQGVADIYRMALGGAPNCGIIRAKRPSDGVI
LGSIVIYNERSALAEHMPVLRATQASVGGISSPVISPCGEHYSTVMQGLVLLAIKQIRKLSADAVVMDCVDGDGN
FDNLSMMGFTMLHSFEEVNCDAASWTMMHA*
Coding >Pro_DTO377G3_2|g9139.t1
ATGGCCCGGAAAGAGGGCATGCTGTCCCCGGGCTGGGAGGACCTAGATAGACAGATGGGTCAGCTCTTTATGATG
GGCTTTGATGGGACTGAGGTCAATCCACAGATTCGATCACTCATTGAGAATTACCACTTGGGTACCGTGATGCTA
TCTGCTAAAAACCTGAAATCGGCCGAGGATGCAACTAGATTGGTTCTGGAATTACAGACCATTGCGCGTGATGCA
GGCCATCCTGTTCCGTTACTAATTGCCTTGGATCAGGAGAATGGTGGCGTCAACAGTTTGTATGATGAGATCTAT
ATCCGCCAATTCCCTAGTACCATGGGCATTGCAGCTACTGGGTCCAAGTCATTAGCGCACGAGGTGGCTGTCGCG
ACAGCACAGGAGCTCAAGGCCGTTGGGGTCAATTGGATATTGGGCCCCGTTTTGGATGTTTTGACCAATGTGCGA
AATCAACCATTAGGCGTTCGTACCGCTGGCGACGATCCCCAAGAGGCGTCTCAATATGGTGTCCAGTTCATGAAA
GGGTATCAAGAAGCAGGTTTAGTAACTTGTGGAAAACACTTTCCGTCCTATGGTAATTTGGAATTTCTCGGCTCC
CCGACGGATGTTCCAATTATTACGGAATCCCTAGAGCAACTCAGTCTCAACGCGCTTGTGCCCTTTCGCAACGCT
ATCAACCAGGGCCTGGATGCCATGATAGTGGGAGGTGTCTCATTGTCATCGGCTGGGATGAACGTGATGCACGCG
TGCCTGAGTGATCAGGTGGTTAACGAGCTATTGAGAAAGGATCTCCAGTTTCAAGGGGTGGTCGTTTCCGAATGC
TTGGAGATGGAGGCGCTCACACATAACATTGGAGTAGGAGGTGGCACAGTGATGGCGAAGAACGCCGGCTGCGAC
GTCATGCTTTTATGTCGGTCATTCCCCGTCCAACAGGAAGCTATCAACGGGTTGAAACTCGGCGTGGAGAACGGT
ATCATCAGCCGTCAGCGGGTTGAACAATCGTTGCGCCGCGTTTTGGATTTGAAGGCGCGGTGTACTTCGTGGGAA
CAGGCACTGAACCCTCCGGGGCTTTCTTCACTTACGCAGATGCAACCCTCGCATACCAACCTTTCCACCCGAGCC
TACAACTCTTCCATCACAGTGATGAGAGATAAGAATAATTTACTTCCATTGTCCAATGTCATCGAGCCAGACGAA
GAACTTTTGCTTCTGACGCCGCTGGTCAAGCCCCTCCCAACATCAGCGGTTTCTCTCTCGGTCGCAGAGTCTGCG
CGTGGGTCACTGGATCCATTATGCTCGGAACGAACCTCCTCGATTCTGAGTGGAGAGGGGGTCTTCAAAGAACTT
GGACGATCACTCTCGCGGCAGAGGAACGGGCGCGTGTTGCACACCTCCTATACTTCCAATGGCGTGCGTCCCATC
CACGACGACCTCATTCAAAGAGCGAGTGCTGTAGTAGTTGTCACGGCCGATGCCAATCGCAATCTCTACCAGCAA
GGGTTCTCAAAACACGTCGCCATGATCTGCCAATCGCAGTATACCCCATCTGGCGAACGTCGCGCGAAACCATTG
ATTGTGGTGGCAGTTAGCTCGCCATATGATTTTGCCATGGATTCCTCAATTGGTACTTACATATGCACGTATGAC
TTCACGGAAACTGCCCTCCAGGCATTGGTCAAGGTCTTGTATGGCGACTTGACACCTTCAGCGGCCCTGCCTGGC
TCCATTGGGCGAACGCAGAAGATTCATCAGTCTCGACAGCACTGGCTTGTCGAGAATTGGAACGAGGATCGCGAC
TCTTTCGCGCTGGATGCCCTGCTCGACACTATCCGTGTCGACTGTACACTAGGCCAGCCGTCAGAACTTCTTGGA
GCTACCGCTAGCAGCTTCTTGCTCCGGAAGGAGGATATCGACGAAGCCCATTTTGTTGTCCGGAACAGTAGCACG
CATGCCCTCTACGGGTTCTGCGCGACCTACTTCTTTCGATCCACGGGCACCGGTGTGATTGCATGTCTGATCGTA
GACCCATCTCGAAGGAAACTCTCAATCGGACATTCCCTTCACAGCCGCGCGATTCGGACTCTGCTCCAGCGGACC
GGCATGAAACGCTTCCAGCTAGGATCCCGATTACCAGGGATCTACCTTGGCATCCCGACCGTCAACCCTGTGGAG
CGCAAGCGGCTGCGGCAGTGGTTCGCGAACATGGGGTGGAACACGGCGCTTTCGCGACCAGTGTGCAGCGTGATC
ATGCGCAACCTGTCGACATGGGTGCCGCCCGAGGGGCTCACGGCGACTCTGCAGAATGCCGAGGTCACATACGAT
CTCGTATATGGCTGGGACTTTGCGCCCGCGATTCTCGACCACATCAAAACGTATGCGCGGCAGGGCGTGGCCGAC
ATCTACCGCATGGCTCTGGGCGGGGCGCCTAATTGCGGGATCATCCGGGCCAAGCGGCCCTCCGACGGGGTTATA
CTCGGGAGTATCGTGATTTACAATGAGCGATCCGCTTTGGCGGAGCACATGCCCGTGTTGCGCGCCACCCAGGCT
TCCGTCGGAGGCATTTCGTCTCCGGTGATTTCTCCTTGTGGCGAACATTACTCTACGGTAATGCAGGGCCTGGTC
CTGCTAGCTATCAAGCAGATCCGGAAGCTGAGTGCCGATGCCGTGGTTATGGACTGTGTCGATGGTGACGGCAAC
TTCGACAATCTCTCGATGATGGGCTTCACTATGCTACATAGTTTTGAGGAAGTGAACTGTGACGCCGCTTCGTGG
ACGATGATGCACGCGTAG
Transcript >Pro_DTO377G3_2|g9139.t1
ATGGCCCGGAAAGAGGGCATGCTGTCCCCGGGCTGGGAGGACCTAGATAGACAGATGGGTCAGCTCTTTATGATG
GGCTTTGATGGGACTGAGGTCAATCCACAGATTCGATCACTCATTGAGAATTACCACTTGGGTACCGTGATGCTA
TCTGCTAAAAACCTGAAATCGGCCGAGGATGCAACTAGATTGGTTCTGGAATTACAGACCATTGCGCGTGATGCA
GGCCATCCTGTTCCGTTACTAATTGCCTTGGATCAGGAGAATGGTGGCGTCAACAGTTTGTATGATGAGATCTAT
ATCCGCCAATTCCCTAGTACCATGGGCATTGCAGCTACTGGGTCCAAGTCATTAGCGCACGAGGTGGCTGTCGCG
ACAGCACAGGAGCTCAAGGCCGTTGGGGTCAATTGGATATTGGGCCCCGTTTTGGATGTTTTGACCAATGTGCGA
AATCAACCATTAGGCGTTCGTACCGCTGGCGACGATCCCCAAGAGGCGTCTCAATATGGTGTCCAGTTCATGAAA
GGGTATCAAGAAGCAGGTTTAGTAACTTGTGGAAAACACTTTCCGTCCTATGGTAATTTGGAATTTCTCGGCTCC
CCGACGGATGTTCCAATTATTACGGAATCCCTAGAGCAACTCAGTCTCAACGCGCTTGTGCCCTTTCGCAACGCT
ATCAACCAGGGCCTGGATGCCATGATAGTGGGAGGTGTCTCATTGTCATCGGCTGGGATGAACGTGATGCACGCG
TGCCTGAGTGATCAGGTGGTTAACGAGCTATTGAGAAAGGATCTCCAGTTTCAAGGGGTGGTCGTTTCCGAATGC
TTGGAGATGGAGGCGCTCACACATAACATTGGAGTAGGAGGTGGCACAGTGATGGCGAAGAACGCCGGCTGCGAC
GTCATGCTTTTATGTCGGTCATTCCCCGTCCAACAGGAAGCTATCAACGGGTTGAAACTCGGCGTGGAGAACGGT
ATCATCAGCCGTCAGCGGGTTGAACAATCGTTGCGCCGCGTTTTGGATTTGAAGGCGCGGTGTACTTCGTGGGAA
CAGGCACTGAACCCTCCGGGGCTTTCTTCACTTACGCAGATGCAACCCTCGCATACCAACCTTTCCACCCGAGCC
TACAACTCTTCCATCACAGTGATGAGAGATAAGAATAATTTACTTCCATTGTCCAATGTCATCGAGCCAGACGAA
GAACTTTTGCTTCTGACGCCGCTGGTCAAGCCCCTCCCAACATCAGCGGTTTCTCTCTCGGTCGCAGAGTCTGCG
CGTGGGTCACTGGATCCATTATGCTCGGAACGAACCTCCTCGATTCTGAGTGGAGAGGGGGTCTTCAAAGAACTT
GGACGATCACTCTCGCGGCAGAGGAACGGGCGCGTGTTGCACACCTCCTATACTTCCAATGGCGTGCGTCCCATC
CACGACGACCTCATTCAAAGAGCGAGTGCTGTAGTAGTTGTCACGGCCGATGCCAATCGCAATCTCTACCAGCAA
GGGTTCTCAAAACACGTCGCCATGATCTGCCAATCGCAGTATACCCCATCTGGCGAACGTCGCGCGAAACCATTG
ATTGTGGTGGCAGTTAGCTCGCCATATGATTTTGCCATGGATTCCTCAATTGGTACTTACATATGCACGTATGAC
TTCACGGAAACTGCCCTCCAGGCATTGGTCAAGGTCTTGTATGGCGACTTGACACCTTCAGCGGCCCTGCCTGGC
TCCATTGGGCGAACGCAGAAGATTCATCAGTCTCGACAGCACTGGCTTGTCGAGAATTGGAACGAGGATCGCGAC
TCTTTCGCGCTGGATGCCCTGCTCGACACTATCCGTGTCGACTGTACACTAGGCCAGCCGTCAGAACTTCTTGGA
GCTACCGCTAGCAGCTTCTTGCTCCGGAAGGAGGATATCGACGAAGCCCATTTTGTTGTCCGGAACAGTAGCACG
CATGCCCTCTACGGGTTCTGCGCGACCTACTTCTTTCGATCCACGGGCACCGGTGTGATTGCATGTCTGATCGTA
GACCCATCTCGAAGGAAACTCTCAATCGGACATTCCCTTCACAGCCGCGCGATTCGGACTCTGCTCCAGCGGACC
GGCATGAAACGCTTCCAGCTAGGATCCCGATTACCAGGGATCTACCTTGGCATCCCGACCGTCAACCCTGTGGAG
CGCAAGCGGCTGCGGCAGTGGTTCGCGAACATGGGGTGGAACACGGCGCTTTCGCGACCAGTGTGCAGCGTGATC
ATGCGCAACCTGTCGACATGGGTGCCGCCCGAGGGGCTCACGGCGACTCTGCAGAATGCCGAGGTCACATACGAT
CTCGTATATGGCTGGGACTTTGCGCCCGCGATTCTCGACCACATCAAAACGTATGCGCGGCAGGGCGTGGCCGAC
ATCTACCGCATGGCTCTGGGCGGGGCGCCTAATTGCGGGATCATCCGGGCCAAGCGGCCCTCCGACGGGGTTATA
CTCGGGAGTATCGTGATTTACAATGAGCGATCCGCTTTGGCGGAGCACATGCCCGTGTTGCGCGCCACCCAGGCT
TCCGTCGGAGGCATTTCGTCTCCGGTGATTTCTCCTTGTGGCGAACATTACTCTACGGTAATGCAGGGCCTGGTC
CTGCTAGCTATCAAGCAGATCCGGAAGCTGAGTGCCGATGCCGTGGTTATGGACTGTGTCGATGGTGACGGCAAC
TTCGACAATCTCTCGATGATGGGCTTCACTATGCTACATAGTTTTGAGGAAGTGAACTGTGACGCCGCTTCGTGG
ACGATGATGCACGCGTAG
Gene >Pro_DTO377G3_2|g9139.t1
ATGGCCCGGAAAGAGGGCATGCTGTCCCCGGGCTGGGAGGACCTAGATAGGTATGTCGATCTACTGTTTTCGCTT
GGCTCGTCCCCTATTGGCGTTAACCCTCGCCCCATTCCTCCCCCCCCTAAAATCTGCCTGTTGGGGTATCTCCCT
TCAATGTGGAACCTAACTGTCAATCTGGAGAGCGTCATGTAGACTATTTCCACTTTAGGAAATTTGACACCGGAG
TACGCTGACATGGCACAGACAGATGGGTCAGCTCTTTATGATGGGCTTTGATGGGACTGAGGTCAATCCACAGAT
TCGATCACTCATTGAGAATTACCACTTGGGTACCGTGATGCTATCTGCTAAAAACCTGAAATGTATCTTTAAAAA
GGCCCTTTGTCACTAGCTACTTAGACAGTCACTGACACGTTTACAGCGGCCGAGGATGCAACTAGATTGGTTCTG
GAATTACAGACCATTGCGCGTGATGCAGGCCATCCTGTTCCGTTACTAATTGCCTTGGATCAGGAGAATGGTGGC
GTCAACAGTTTGTATGATGAGATCTATATCCGCCAATTCCCTAGTACCATGGGCATTGCAGCTACTGGGTCCAAG
TCATTAGCGCACGAGGTGGCTGTCGCGACAGCACAGGAGCTCAAGGCCGTTGGGGTCAATTGGATATTGGGCCCC
GTTTTGGATGTTTTGACCAATGTGCGAAATCAACCATTAGGCGTTCGTACCGCTGGCGACGATCCCCAAGAGGCG
TCTCAATATGGTGTCCAGTTCATGAAAGGGTATCAAGAAGCAGGTTTAGTAACTTGTGGAAAACACTTTCCGTCC
TATGGTAATTTGGAATTTCTCGGCTCCCCGACGGATGTTCCAATTATTACGGAATCCCTAGAGCAACTCAGTCTC
AACGCGCTTGTGCCCTTTCGCAACGCTATCAACCAGGGCCTGGATGCCATGATAGTGGGAGGTGTCTCATTGTCA
TCGGCTGGGATGAACGTGATGCACGCGTGCCTGAGTGATCAGGTGGTTAACGAGCTATTGAGAAAGGATCTCCAG
TTTCAAGGGGTGGTCGTTTCCGAATGCTTGGAGATGGAGGCGCTCACACATAACATTGGAGTAGGAGGTGGCACA
GTGATGGCGAAGAACGCCGGCTGCGACGTCATGCTTTTATGTCGGTCATTCCCCGTCCAACAGGAAGCTATCAAC
GGGTTGAAACTCGGCGTGGAGAACGGTATCATCAGCCGTCAGCGGGTTGAACAATCGTTGCGCCGCGTTTTGGAT
TTGAAGGCGCGGTGTACTTCGTGGGAACAGGCACTGAACCCTCCGGGGCTTTCTTCACTTACGCAGATGCAACCC
TCGCATACCAACCTTTCCACCCGAGCCTACAACTCTTCCATCACAGTGATGAGAGATAAGAATAATTTACTTCCA
TTGTCCAATGTCATCGAGCCAGACGAAGAACTTTTGCTTCTGACGCCGCTGGTCAAGCCCCTCCCAACATCAGCG
GTTTCTCTCTCGGTCGCAGAGTCTGCGCGTGGGTCACTGGATCCATTATGCTCGGAACGAACCTCCTCGATTCTG
AGTGGAGAGGGGGTCTTCAAAGAACTTGGACGATCACTCTCGCGGCAGAGGAACGGGCGCGTGTTGCACACCTCC
TATACTTCCAATGGCGTGCGTCCCATCCACGACGACCTCATTCAAAGAGCGAGTGCTGTAGTAGTTGTCACGGCC
GATGCCAATCGCAATCTCTACCAGCAAGGGTTCTCAAAACACGTCGCCATGATCTGCCAATCGCAGTATACCCCA
TCTGGCGAACGTCGCGCGAAACCATTGATTGTGGTGGCAGTTAGCTCGCCATATGATTTTGCCATGGATTCCTCA
ATTGGTACTTACATATGCACGTATGACTTCACGGAAACTGCCCTCCAGGCATTGGTCAAGGTCTTGTATGGCGAC
TTGACACCTTCAGCGGCCCTGCCTGGCTCCATTGGGCGAACGCAGAAGATTCATCAGTCTCGACAGCACTGGCTT
GTCGAGAATTGGAACGAGGATCGCGACTCTTTCGCGCTGGATGCCCTGCTCGACACTATCCGTGTCGACTGTACA
CTAGGCCAGCCGTCAGAACTTCTTGGAGCTACCGCTAGCAGCTTCTTGCTCCGGAAGGAGGATATCGACGAAGCC
CATTTTGTTGTCCGGAACAGTAGCACGCATGCCCTCTACGGGTTCTGCGCGACCTACTTCTTTCGATCCACGGGC
ACCGGTGTGATTGCATGTCTGATCGTAGACCCATCTCGAAGGAAACTCTCAATCGGACATTCCCTTCACAGCCGC
GCGATTCGGACTCTGCTCCAGCGGACCGGCATGAAACGCTTCCAGCTAGGATCCCGATTACCAGGGATCTACCTT
GGCATCCCGACCGTCAACCCTGTGGAGCGCAAGCGGCTGCGGCAGTGGTTCGCGAACATGGGGTGGAACACGGCG
CTTTCGCGACCAGTGTGCAGCGTGATCATGCGCAACCTGTCGACATGGGTGCCGCCCGAGGGGCTCACGGCGACT
CTGCAGAATGCCGAGGTCACATACGATCTCGTATATGGCTGGGACTTTGCGCCCGCGATTCTCGACCACATCAAA
ACGTATGCGCGGCAGGGCGTGGCCGACATCTACCGCATGGCTCTGGGCGGGGCGCCTAATTGCGGGATCATCCGG
GCCAAGCGGCCCTCCGACGGGGTTATACTCGGGAGTATCGTGATTTACAATGAGCGATCCGCTTTGGCGGAGCAC
ATGCCCGTGTTGCGCGCCACCCAGGCTTCCGTCGGAGGCATTTCGTCTCCGGTGATTTCTCCTTGTGGCGAACAT
TACTCTACGGTAATGCAGGGCCTGGTCCTGCTAGCTATCAAGCAGATCCGGAAGCTGAGTGCCGATGCCGTGGTT
ATGGACTGTGTATGTTTTTTTGGGCTTGTTCCTTTTCCCCGGTTATCTTCTAACACTGGAATAGGTCGATGGTGA
CGGCAACTTCGACAATCTCTCGATGATGGGCTTCACTATGCTACATAGTTTTGAGGAAGTGAACTGTGACGCCGC
TTCGTGGACGATGATGCACGCGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail