Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g9136.t1
Gene name
Locationscaffold_42:57132..59009
Strand-
Gene length (bp)1877
Transcript length (bp)1743
Coding sequence length (bp)1743
Protein length (aa) 581

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04791 LMBR1 LMBR1-like membrane protein 5.0E-21 14 271

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 19 0.5

Transmembrane Domains

Domain # Start End Length
1 7 29 22
2 39 61 22
3 95 117 22
4 145 167 22
5 188 210 22
6 312 334 22
7 347 364 17
8 374 396 22
9 417 439 22
10 504 526 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g9136.t1
MALLQTSLIWAVYGVVVAILLAVASVFIYVYQTPRDRSPSVTLACIISITSLLATVLLLPVDVALVSSTTSSELG
QRKDWATQDVVDRITYSLTIIYYLLYSLDALLCLLVIPFTYFWYEEYDEVATEEGDQTLGQRIWGALKYTLSFFA
VVVILFLVGFFVPVSRGKNDMDLDYFRRLLTENHGERALTFALGLLMTIGLCLYVLYTSVGLALLPISLIKTAPS
ISSATLRASTTQQLDVNQERQRQLEGRCAGDPDLLSSKDRRELDTLVREERTLIRRQRLAEESQGGGRSWLIRAW
YKLGAVFRPFKLLGGVLLLFIAFLTWVSMLLTAIDKAKNSICKHRCGYILAHVNIFNPVNWALVKSARFFPIDYA
IFTALVLLFFCSSVVGIAVVGIRFLWVRIFQIRNGHTSPQALLLATAMLMLIILALNYSISMIVAPQYATFGPQT
FCDRAPGAFIGMPDCSNTKELIKPCSELAKNPAAQQVCTPSVVSTFLNRVTLNYPFFGVVFFWAQFFFLGLYLIV
FVTSLLRSPQLDEAQLDDDAEEAEEEGLLANTGRRFNASWQDITGRATRSDRPRE*
Coding >Pro_DTO377G3_2|g9136.t1
ATGGCACTCCTTCAGACTTCCCTCATCTGGGCTGTGTATGGGGTGGTGGTAGCTATTCTACTGGCAGTGGCGTCA
GTGTTTATCTACGTCTACCAAACTCCCCGTGACCGCTCTCCTTCAGTCACTCTGGCTTGCATCATCTCAATTACT
AGTCTTCTCGCAACAGTGCTTCTGCTGCCTGTCGATGTCGCTTTGGTATCATCGACTACATCGTCCGAGTTAGGC
CAGCGAAAGGACTGGGCAACACAGGATGTGGTGGACAGAATCACTTATTCCTTGACCATCATCTACTATCTTCTC
TACTCTTTGGATGCCTTGCTCTGTCTTCTGGTCATCCCCTTCACATATTTCTGGTATGAGGAATATGATGAGGTT
GCGACCGAGGAGGGGGACCAAACTTTGGGCCAACGGATTTGGGGTGCCCTCAAATACACTCTCTCATTCTTTGCA
GTCGTCGTGATCTTGTTCTTAGTTGGCTTCTTCGTCCCAGTGTCACGAGGAAAGAATGATATGGACCTGGATTAC
TTCAGGCGCTTACTGACTGAAAATCATGGGGAGCGCGCTCTCACTTTTGCTCTCGGTCTGTTGATGACAATTGGG
CTCTGTCTTTATGTCTTATACACATCCGTGGGACTGGCCCTTCTGCCAATCAGTTTGATCAAGACTGCACCATCA
ATCTCTAGTGCTACCCTGCGAGCGAGCACCACACAACAACTTGACGTAAACCAGGAGCGGCAACGGCAGCTTGAG
GGACGATGTGCCGGAGATCCCGACCTTCTGTCCTCCAAAGATCGTCGAGAACTTGATACACTAGTGCGGGAAGAA
AGGACCCTGATTCGGCGCCAACGCCTAGCCGAAGAATCCCAAGGCGGAGGCCGCAGCTGGTTGATAAGGGCATGG
TACAAACTTGGAGCAGTATTCCGTCCCTTCAAGCTCCTGGGGGGCGTCTTGCTGCTATTCATTGCTTTCTTAACG
TGGGTATCCATGCTCTTGACCGCAATTGACAAAGCAAAGAATTCGATTTGCAAGCATCGTTGTGGATACATCCTC
GCACATGTCAACATCTTTAATCCCGTCAACTGGGCACTTGTTAAATCTGCCAGGTTCTTTCCCATTGACTATGCC
ATATTTACTGCACTTGTATTGCTATTTTTCTGCAGTTCTGTGGTTGGAATCGCCGTGGTCGGAATCCGCTTCCTA
TGGGTCAGGATTTTCCAAATCAGAAACGGCCACACATCTCCCCAGGCTCTACTTTTGGCCACCGCCATGTTGATG
CTGATCATTTTAGCGCTGAATTATTCGATTTCAATGATAGTCGCGCCCCAGTATGCGACATTTGGGCCACAGACA
TTCTGCGATCGCGCTCCGGGAGCTTTCATTGGAATGCCAGATTGTTCAAACACCAAAGAACTTATCAAGCCATGC
TCAGAGTTGGCGAAGAATCCTGCTGCGCAGCAAGTCTGCACACCAAGTGTCGTGAGCACCTTCTTGAATCGGGTC
ACGCTGAACTACCCATTCTTTGGAGTGGTGTTCTTTTGGGCTCAGTTCTTCTTCCTCGGCTTATATCTAATTGTC
TTTGTTACTTCCCTTCTCCGTTCACCTCAGTTGGATGAAGCGCAACTCGACGACGATGCAGAGGAAGCTGAGGAG
GAAGGTTTATTGGCCAACACCGGCAGACGCTTCAACGCCAGCTGGCAAGATATCACAGGGAGAGCTACCCGGAGT
GACCGCCCCCGGGAATAA
Transcript >Pro_DTO377G3_2|g9136.t1
ATGGCACTCCTTCAGACTTCCCTCATCTGGGCTGTGTATGGGGTGGTGGTAGCTATTCTACTGGCAGTGGCGTCA
GTGTTTATCTACGTCTACCAAACTCCCCGTGACCGCTCTCCTTCAGTCACTCTGGCTTGCATCATCTCAATTACT
AGTCTTCTCGCAACAGTGCTTCTGCTGCCTGTCGATGTCGCTTTGGTATCATCGACTACATCGTCCGAGTTAGGC
CAGCGAAAGGACTGGGCAACACAGGATGTGGTGGACAGAATCACTTATTCCTTGACCATCATCTACTATCTTCTC
TACTCTTTGGATGCCTTGCTCTGTCTTCTGGTCATCCCCTTCACATATTTCTGGTATGAGGAATATGATGAGGTT
GCGACCGAGGAGGGGGACCAAACTTTGGGCCAACGGATTTGGGGTGCCCTCAAATACACTCTCTCATTCTTTGCA
GTCGTCGTGATCTTGTTCTTAGTTGGCTTCTTCGTCCCAGTGTCACGAGGAAAGAATGATATGGACCTGGATTAC
TTCAGGCGCTTACTGACTGAAAATCATGGGGAGCGCGCTCTCACTTTTGCTCTCGGTCTGTTGATGACAATTGGG
CTCTGTCTTTATGTCTTATACACATCCGTGGGACTGGCCCTTCTGCCAATCAGTTTGATCAAGACTGCACCATCA
ATCTCTAGTGCTACCCTGCGAGCGAGCACCACACAACAACTTGACGTAAACCAGGAGCGGCAACGGCAGCTTGAG
GGACGATGTGCCGGAGATCCCGACCTTCTGTCCTCCAAAGATCGTCGAGAACTTGATACACTAGTGCGGGAAGAA
AGGACCCTGATTCGGCGCCAACGCCTAGCCGAAGAATCCCAAGGCGGAGGCCGCAGCTGGTTGATAAGGGCATGG
TACAAACTTGGAGCAGTATTCCGTCCCTTCAAGCTCCTGGGGGGCGTCTTGCTGCTATTCATTGCTTTCTTAACG
TGGGTATCCATGCTCTTGACCGCAATTGACAAAGCAAAGAATTCGATTTGCAAGCATCGTTGTGGATACATCCTC
GCACATGTCAACATCTTTAATCCCGTCAACTGGGCACTTGTTAAATCTGCCAGGTTCTTTCCCATTGACTATGCC
ATATTTACTGCACTTGTATTGCTATTTTTCTGCAGTTCTGTGGTTGGAATCGCCGTGGTCGGAATCCGCTTCCTA
TGGGTCAGGATTTTCCAAATCAGAAACGGCCACACATCTCCCCAGGCTCTACTTTTGGCCACCGCCATGTTGATG
CTGATCATTTTAGCGCTGAATTATTCGATTTCAATGATAGTCGCGCCCCAGTATGCGACATTTGGGCCACAGACA
TTCTGCGATCGCGCTCCGGGAGCTTTCATTGGAATGCCAGATTGTTCAAACACCAAAGAACTTATCAAGCCATGC
TCAGAGTTGGCGAAGAATCCTGCTGCGCAGCAAGTCTGCACACCAAGTGTCGTGAGCACCTTCTTGAATCGGGTC
ACGCTGAACTACCCATTCTTTGGAGTGGTGTTCTTTTGGGCTCAGTTCTTCTTCCTCGGCTTATATCTAATTGTC
TTTGTTACTTCCCTTCTCCGTTCACCTCAGTTGGATGAAGCGCAACTCGACGACGATGCAGAGGAAGCTGAGGAG
GAAGGTTTATTGGCCAACACCGGCAGACGCTTCAACGCCAGCTGGCAAGATATCACAGGGAGAGCTACCCGGAGT
GACCGCCCCCGGGAATAA
Gene >Pro_DTO377G3_2|g9136.t1
ATGGCACTCCTTCAGACTTCCCTCATCTGGGCTGTGTATGGGGTGGTGGTAGCTATTCTACTGGCAGTGGCGTCA
GTGTTTATCTACGTCTACCAAACTCCCCGTGACCGCTCTCCTTCAGTCACTCTGGCTTGCATCATCTCAATTACT
AGTCTTCTCGCAACAGTGCTTCTGCTGCCTGTCGATGTCGCTTTGGTATCATCGACTACATCGTCCGAGTTAGGC
CAGCGAAAGGACTGGGCAACACAGGATGTGGTGGACAGAATCACTTATTCCTTGACCATCATCTACTATCTTCTC
TACTCTTTGGATGCCTTGCTCTGTCTTCTGGTCATCCCCTTCACATATTTCTGGTATGAGGAATATGATGAGGTT
GCGACCGAGGAGGGGGACCAAACTTTGGGCCAACGGATTTGGGGTGCCCTCAAATACACTCTCTCATTCTTTGCA
GTCGTCGTGATCTTGTTCTTAGTTGGCTTCTTCGTCCCAGTGTCACGAGGAAAGAATGATATGGACCTGGATTAC
TTCAGGCGCTTACTGACTGAAAATCGTGAGTATTCGAGTATTCTGTCGTGTAACACAAATGTGAAGCTGACATAA
CTCTGAAAAGATGGGGAGCGCGCTCTCACTTTTGCTCTCGGTCTGTTGATGACAATTGGGCTCTGTCTTTATGTC
TTATACACATCCGTGGGACTGGCCCTTCTGCCAATCAGTTTGATCAAGACTGCACCATCAATCTCTAGTGCTACC
CTGCGAGCGAGCACCACACAACAACTTGACGTAAACCAGGAGCGGCAACGGCAGCTTGAGGGACGATGTGCCGGA
GATCCCGACCTTCTGTCCTCCAAAGATCGTCGAGAACTTGATACACTAGTGCGGGAAGAAAGGACCCTGATTCGG
CGCCAACGCCTAGCCGAAGAATCCCAAGGCGGAGGCCGCAGCTGGTTGATAAGGGCATGGTACAAACTTGGAGCA
GTATTCCGTCCCTTCAAGCTCCTGGGGGGCGTCTTGCTGCTATTCATTGCTTTCTTAACGTGGGTATCCATGCTC
TTGACCGCAATTGACAAAGCAAAGAATTCGATTTGCAAGCATCGTTGTGGATACATCCTCGCACATGTCAACATC
TTTAATCCCGTCAACTGGGCACTTGTTAAATCTGCCAGGTTCTTTCCCATTGACTATGCCATATTTACTGCACTT
GTATTGCTATTTTTCTGCAGTTCTGTGGTTGGAATCGCCGTGGTCGGAATCCGCTTCCTATGGGTCAGGATTTTC
CAAATCAGAAACGGCCACACATCTCCCCAGGCTCTACTTTTGGCCACCGCCATGTTGATGCTGATCATTTTAGCG
CTGAATTATTCGATTTCAATGATAGTCGCGCCCCAGTATGCGACATTTGGGCCACAGACATTCTGCGATCGCGCT
CCGGGAGCTTTCATTGGAATGCCAGATTGTTCAAACACCAAAGAACTTATCAAGCCATGCTCAGAGTTGGCGAAG
AATCCTGCTGCGCAGCAAGTCTGCACACCAAGTGTCGTGAGCACCTTCTTGAATCGGGTCACGCTGAACTACCCA
TTCTTTGGAGTGGTGTTCTTTTGGGCTCAGTTCTTCTTCCTCGGTAAGTCTCAATCTTGTCTTGTTGCATTCCTA
CCAGAGTTCCATGTTCGCGTTAATCTAACACCAACATCACAGGCTTATATCTAATTGTCTTTGTTACTTCCCTTC
TCCGTTCACCTCAGTTGGATGAAGCGCAACTCGACGACGATGCAGAGGAAGCTGAGGAGGAAGGTTTATTGGCCA
ACACCGGCAGACGCTTCAACGCCAGCTGGCAAGATATCACAGGGAGAGCTACCCGGAGTGACCGCCCCCGGGAAT
AA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail