Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g9132.t1
Gene name
Locationscaffold_42:49981..51426
Strand+
Gene length (bp)1445
Transcript length (bp)1200
Coding sequence length (bp)1200
Protein length (aa) 400

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00108 Thiolase_N Thiolase, N-terminal domain 3.5E-92 7 268
PF02803 Thiolase_C Thiolase, C-terminal domain 2.5E-43 276 397
PF00109 ketoacyl-synt Beta-ketoacyl synthase, N-terminal domain 2.7E-06 87 135

GO

GO Term Description Terminal node
GO:0016747 acyltransferase activity, transferring groups other than amino-acyl groups Yes
GO:0016746 acyltransferase activity No
GO:0016740 transferase activity No
GO:0003674 molecular_function No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 40 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 78.14 47.28 109.00
5d_25C Five days - 25 degrees Celsius 59.15 35.04 83.26
7d_25C Seven days - 25 degrees Celsius 64.01 37.95 90.07
10d_25C Ten days - 25 degrees Celsius 44.26 24.97 63.55
7d_15C Seven days - 15 degrees Celsius 65.41 37.16 93.66
7d_30C Seven days - 30 degrees Celsius 77.65 46.37 108.93

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.240174 no
3d_25C 7d_25C 0.436249 no
3d_25C 7d_15C 0.510153 no
3d_25C 7d_30C 0.986318 no
3d_25C 10d_25C 0.006742 yes
5d_25C 7d_25C 0.802101 no
5d_25C 7d_15C 0.751730 no
5d_25C 7d_30C 0.270887 no
5d_25C 10d_25C 0.242106 no
7d_25C 7d_15C 0.954719 no
7d_25C 7d_30C 0.471142 no
7d_25C 10d_25C 0.113395 no
7d_15C 7d_30C 0.549594 no
7d_15C 10d_25C 0.103711 no
7d_30C 10d_25C 0.009770 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g9132.t1
MSSLPPVYIVSTARTPVGSFLGSLSSLTAPQLGAHAIKAAVERAEGINASDVEEVFFGNVLSAGVGQNPARQCAL
GAGLTDSTICTTVNKVCASGLKAIILGAQTIMTGNADIVVAGGTESMSNTPHYLQTSRSGTKFGSQALVDGIQND
GLTDAYGKHDLMGVAAEECAAEHGFNRTQQDDYAIRSYEKAQAAQKSGAFDNEIAPIEIPGFRGKPGVTVSRDEE
PKNLNPEKLRAIKPAFIPGTGTVTAPNSSPLNDGSAAVVLVSEAKVKELGLKPIAKILGWGDAEQQPSKFTTAPA
LAIPKALKHAGVSQESIDAFEINEAFSVVALANMKLLGLSEDKVNIHGGAVAIGHPLGASGARIVSTLLGVLSAK
EGKLGCVGICNGGGGASALVIESL*
Coding >Pro_DTO377G3_2|g9132.t1
ATGTCTTCTCTTCCTCCTGTCTACATTGTTTCTACTGCCCGTACTCCCGTGGGCTCTTTCCTGGGCTCCCTGTCT
AGCTTGACTGCTCCTCAGCTTGGTGCACATGCCATTAAGGCCGCTGTTGAACGGGCCGAGGGTATCAATGCCTCT
GACGTTGAGGAAGTCTTCTTCGGTAACGTCTTGTCTGCTGGTGTTGGACAAAATCCCGCCAGACAGTGCGCCCTC
GGTGCTGGCCTTACCGATTCTACCATCTGCACTACTGTCAACAAGGTCTGTGCTTCTGGCCTGAAGGCCATCATT
CTTGGTGCCCAGACTATCATGACCGGAAACGCGGATATTGTTGTCGCTGGTGGTACCGAGTCCATGTCTAACACC
CCTCACTATCTGCAAACATCTCGCAGCGGTACCAAGTTTGGTAGCCAGGCCCTAGTTGACGGCATCCAGAATGAT
GGTTTGACTGATGCCTACGGCAAGCACGATCTCATGGGTGTTGCGGCCGAGGAGTGTGCCGCGGAGCACGGCTTC
AACCGTACTCAGCAGGATGACTATGCTATCCGCAGCTATGAGAAGGCCCAGGCTGCCCAGAAGTCCGGTGCATTT
GACAACGAGATTGCCCCTATTGAGATCCCCGGCTTCCGTGGCAAGCCTGGCGTGACTGTTTCCCGGGATGAGGAA
CCCAAGAACCTCAACCCTGAGAAGCTCCGCGCTATAAAGCCCGCCTTCATTCCGGGAACTGGAACCGTGACCGCC
CCCAACTCTTCGCCCCTGAACGATGGTTCTGCAGCCGTTGTCTTGGTTTCGGAGGCTAAGGTGAAGGAGCTGGGC
CTCAAGCCTATTGCCAAGATTCTAGGTTGGGGAGATGCTGAGCAACAGCCCAGCAAGTTCACTACTGCTCCTGCT
TTGGCTATCCCCAAGGCTCTCAAGCACGCCGGTGTGAGCCAGGAGTCCATCGATGCCTTTGAGATCAACGAGGCC
TTCAGTGTTGTGGCTCTTGCCAATATGAAGCTCCTTGGTCTCTCTGAGGATAAGGTCAACATCCACGGTGGTGCA
GTCGCCATTGGACACCCTCTTGGTGCCAGTGGTGCCCGTATTGTGTCTACCTTGCTCGGTGTCTTGAGCGCCAAG
GAGGGCAAGCTTGGCTGCGTCGGCATCTGCAACGGTGGCGGCGGTGCCAGCGCCCTGGTTATTGAGTCTCTTTAA
Transcript >Pro_DTO377G3_2|g9132.t1
ATGTCTTCTCTTCCTCCTGTCTACATTGTTTCTACTGCCCGTACTCCCGTGGGCTCTTTCCTGGGCTCCCTGTCT
AGCTTGACTGCTCCTCAGCTTGGTGCACATGCCATTAAGGCCGCTGTTGAACGGGCCGAGGGTATCAATGCCTCT
GACGTTGAGGAAGTCTTCTTCGGTAACGTCTTGTCTGCTGGTGTTGGACAAAATCCCGCCAGACAGTGCGCCCTC
GGTGCTGGCCTTACCGATTCTACCATCTGCACTACTGTCAACAAGGTCTGTGCTTCTGGCCTGAAGGCCATCATT
CTTGGTGCCCAGACTATCATGACCGGAAACGCGGATATTGTTGTCGCTGGTGGTACCGAGTCCATGTCTAACACC
CCTCACTATCTGCAAACATCTCGCAGCGGTACCAAGTTTGGTAGCCAGGCCCTAGTTGACGGCATCCAGAATGAT
GGTTTGACTGATGCCTACGGCAAGCACGATCTCATGGGTGTTGCGGCCGAGGAGTGTGCCGCGGAGCACGGCTTC
AACCGTACTCAGCAGGATGACTATGCTATCCGCAGCTATGAGAAGGCCCAGGCTGCCCAGAAGTCCGGTGCATTT
GACAACGAGATTGCCCCTATTGAGATCCCCGGCTTCCGTGGCAAGCCTGGCGTGACTGTTTCCCGGGATGAGGAA
CCCAAGAACCTCAACCCTGAGAAGCTCCGCGCTATAAAGCCCGCCTTCATTCCGGGAACTGGAACCGTGACCGCC
CCCAACTCTTCGCCCCTGAACGATGGTTCTGCAGCCGTTGTCTTGGTTTCGGAGGCTAAGGTGAAGGAGCTGGGC
CTCAAGCCTATTGCCAAGATTCTAGGTTGGGGAGATGCTGAGCAACAGCCCAGCAAGTTCACTACTGCTCCTGCT
TTGGCTATCCCCAAGGCTCTCAAGCACGCCGGTGTGAGCCAGGAGTCCATCGATGCCTTTGAGATCAACGAGGCC
TTCAGTGTTGTGGCTCTTGCCAATATGAAGCTCCTTGGTCTCTCTGAGGATAAGGTCAACATCCACGGTGGTGCA
GTCGCCATTGGACACCCTCTTGGTGCCAGTGGTGCCCGTATTGTGTCTACCTTGCTCGGTGTCTTGAGCGCCAAG
GAGGGCAAGCTTGGCTGCGTCGGCATCTGCAACGGTGGCGGCGGTGCCAGCGCCCTGGTTATTGAGTCTCTTTAA
Gene >Pro_DTO377G3_2|g9132.t1
ATGTCTTCTCTTCCTCCTGTCTACATTGTTTCTACTGCCCGTACTCCCGTGGGCTCTTTCCTGGGGTGAGCATGC
TTGCATTCGTCTTTTCCCCCTTGAAGACTTGATCTGACATCGGTTACTGTAGCTCCCTGTCTAGCTTGACTGCTC
CTCAGCTTGGTGCACATGCCATTAAGGGTAGGGCATATACCCCAAGCTATACTATACCTATTTTCAATGCTAATA
GTAACTTGCAGCCGCTGTTGAACGGGCCGAGGGTATCAATGCCTCTGACGTTGAGGAAGTCTTCTTCGGTAACGT
CTTGTCTGCTGGGTAAGTTATCTTTGCTACATCTTATACTGCAATTGAGATTGACGTATTCCTTATAGTGTTGGA
CAAAATCCCGCCAGACAGTGCGCCCTCGGTGCTGGCCTTACCGATTCTACCATCTGCACTACTGTCAACAAGGTC
TGTGCTTCTGGCCTGAAGGCCATCATTCTTGGTGCCCAGACTATCATGACCGGAAACGCGGATATTGTTGTCGCT
GGTGGTACCGAGTCCATGTCTAACACCCCTCACTATCTGCAAACATCTCGCAGCGGTACCAAGTTTGGTAGCCAG
GCCCTAGTTGACGGCATCCAGAATGATGGTTTGACTGATGCCTACGGCAAGCACGATCTCATGGGTGTTGCGGCC
GAGGAGTGTGCCGCGGAGCACGGCTTCAACCGTACTCAGCAGGATGACTATGCTATCCGCAGCTATGAGAAGGCC
CAGGCTGCCCAGAAGTCCGGTGCATTTGACAACGAGATTGCCCCTATTGAGATCCCCGGCTTCCGTGGCAAGCCT
GGCGTGACTGTTTCCCGGGATGAGGAACCCAAGAACGTGAGTTCCTCTTGTTCTCTGCGTTAGATTTATTGTGAC
GTTCATTGACCGTTCTTTGCGACTTATAGCTCAACCCTGAGAAGCTCCGCGCTATAAAGCCCGCCTTCATTCCGG
GAACTGGAACCGTGACCGCCCCCAACTCTTCGCCCCTGAACGATGGTTCTGCAGCCGTTGTCTTGGTTTCGGAGG
CTAAGGTGAAGGAGCTGGGCCTCAAGCCTATTGCCAAGATTCTAGGTTGGGGAGATGCTGAGCAACAGCCCAGCA
AGTTCACTACTGCTCCTGCTTTGGCTATCCCCAAGGCTCTCAAGCACGCCGGTGTGAGCCAGGAGTCCATCGATG
CCTTTGAGATCAACGAGGCCTTCAGTGTTGTGGCTCTTGCCAATATGAAGCTCCTTGGTCTCTCTGAGGATAAGG
TCAACATCCACGGTGGTGCAGTCGCCATTGGACACCCTCTTGGTGCCAGTGGTGCCCGTATTGTGTCTACCTTGC
TCGGTGTCTTGAGCGCCAAGGAGGGCAAGCTTGGCTGCGTCGGCATCTGCAACGGTGGCGGCGGTGCCAGCGCCC
TGGTTATTGAGTCTCTTTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail