Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g9115.t1
Gene name
Locationscaffold_41:159439..159874
Strand-
Gene length (bp)435
Transcript length (bp)435
Coding sequence length (bp)435
Protein length (aa) 145

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 18 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 167.85 92.32 243.39
5d_25C Five days - 25 degrees Celsius 136.29 71.43 201.15
7d_25C Seven days - 25 degrees Celsius 113.28 56.51 170.06
10d_25C Ten days - 25 degrees Celsius 90.64 42.74 138.53
7d_15C Seven days - 15 degrees Celsius 128.86 65.01 192.70
7d_30C Seven days - 30 degrees Celsius 78.78 36.26 121.30

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.493418 no
3d_25C 7d_25C 0.153953 no
3d_25C 7d_15C 0.364228 no
3d_25C 7d_30C 0.004450 yes
3d_25C 10d_25C 0.018838 yes
5d_25C 7d_25C 0.577266 no
5d_25C 7d_15C 0.889421 no
5d_25C 7d_30C 0.046552 yes
5d_25C 10d_25C 0.149982 no
7d_25C 7d_15C 0.725659 no
7d_25C 7d_30C 0.241077 no
7d_25C 10d_25C 0.507947 no
7d_15C 7d_30C 0.079555 no
7d_15C 10d_25C 0.231043 no
7d_30C 10d_25C 0.714949 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g9115.t1
MQLTTILPIVLAGLASARPASLQTKTITDDIIWGVSNFTIGCSPGGCVYRYDIVGRENTMTPKFRTNCSGVTDER
VLCDDKNITTIVSPAENPVWNVDVTHTWKSQLSDNTLATWYQHGAKNVTVPDHNPIQFVMKPTQEYGIA*
Coding >Pro_DTO377G3_2|g9115.t1
ATGCAACTTACCACCATCCTCCCAATCGTGCTCGCCGGCCTAGCCAGTGCACGCCCCGCCAGCCTACAGACTAAG
ACCATCACCGACGACATCATCTGGGGCGTATCCAACTTCACCATAGGCTGCTCCCCAGGCGGCTGTGTCTACAGA
TACGACATTGTCGGCCGCGAGAACACAATGACCCCCAAGTTCCGCACCAACTGCAGCGGCGTCACAGACGAGCGG
GTCCTCTGCGACGACAAGAACATCACGACCATTGTTTCTCCTGCTGAAAACCCGGTCTGGAATGTCGATGTCACT
CACACCTGGAAATCCCAGCTCAGTGACAATACCCTCGCGACTTGGTACCAGCACGGCGCGAAGAATGTTACCGTC
CCTGACCACAACCCGATTCAGTTTGTTATGAAGCCTACTCAGGAGTATGGCATTGCATAA
Transcript >Pro_DTO377G3_2|g9115.t1
ATGCAACTTACCACCATCCTCCCAATCGTGCTCGCCGGCCTAGCCAGTGCACGCCCCGCCAGCCTACAGACTAAG
ACCATCACCGACGACATCATCTGGGGCGTATCCAACTTCACCATAGGCTGCTCCCCAGGCGGCTGTGTCTACAGA
TACGACATTGTCGGCCGCGAGAACACAATGACCCCCAAGTTCCGCACCAACTGCAGCGGCGTCACAGACGAGCGG
GTCCTCTGCGACGACAAGAACATCACGACCATTGTTTCTCCTGCTGAAAACCCGGTCTGGAATGTCGATGTCACT
CACACCTGGAAATCCCAGCTCAGTGACAATACCCTCGCGACTTGGTACCAGCACGGCGCGAAGAATGTTACCGTC
CCTGACCACAACCCGATTCAGTTTGTTATGAAGCCTACTCAGGAGTATGGCATTGCATAA
Gene >Pro_DTO377G3_2|g9115.t1
ATGCAACTTACCACCATCCTCCCAATCGTGCTCGCCGGCCTAGCCAGTGCACGCCCCGCCAGCCTACAGACTAAG
ACCATCACCGACGACATCATCTGGGGCGTATCCAACTTCACCATAGGCTGCTCCCCAGGCGGCTGTGTCTACAGA
TACGACATTGTCGGCCGCGAGAACACAATGACCCCCAAGTTCCGCACCAACTGCAGCGGCGTCACAGACGAGCGG
GTCCTCTGCGACGACAAGAACATCACGACCATTGTTTCTCCTGCTGAAAACCCGGTCTGGAATGTCGATGTCACT
CACACCTGGAAATCCCAGCTCAGTGACAATACCCTCGCGACTTGGTACCAGCACGGCGCGAAGAATGTTACCGTC
CCTGACCACAACCCGATTCAGTTTGTTATGAAGCCTACTCAGGAGTATGGCATTGCATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail