Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g9103.t1
Gene name
Locationscaffold_41:132586..135469
Strand+
Gene length (bp)2883
Transcript length (bp)2610
Coding sequence length (bp)2610
Protein length (aa) 870

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00515 TPR_1 Tetratricopeptide repeat 1.4E-06 238 270
PF00515 TPR_1 Tetratricopeptide repeat 5.6E-08 345 374
PF07719 TPR_2 Tetratricopeptide repeat 5.8E-06 238 270
PF07719 TPR_2 Tetratricopeptide repeat 2.0E-05 345 374
PF13181 TPR_8 Tetratricopeptide repeat 2.7E-02 60 87
PF13181 TPR_8 Tetratricopeptide repeat 1.4E-01 94 126
PF13181 TPR_8 Tetratricopeptide repeat 2.1E-06 238 270
PF13181 TPR_8 Tetratricopeptide repeat 1.1E-03 309 339
PF13181 TPR_8 Tetratricopeptide repeat 2.6E-02 345 374
PF13431 TPR_17 Tetratricopeptide repeat 2.7E-05 259 287
PF13432 TPR_16 Tetratricopeptide repeat 1.0E-04 243 302
PF13432 TPR_16 Tetratricopeptide repeat 5.2E-05 350 411
PF13174 TPR_6 Tetratricopeptide repeat 9.5E-03 240 270
PF13174 TPR_6 Tetratricopeptide repeat 5.1E-02 311 337
PF13176 TPR_7 Tetratricopeptide repeat 3.1E-02 240 271
PF12895 ANAPC3 Anaphase-promoting complex, cyclosome, subunit 3 1.3E-07 292 368

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0005488 binding No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 31 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g9103.t1
MSHTQPSPTTGVAPHHAAAHLAHAQAQAQANGHMSAIPVQGQKGVPTLTTAQKIATLNEQVWLQIGSLTELMGDL
EGAMNAYEQALRHNQWSISAMNAISCILRTKEQFPKAIEYLQNILKLDPSNGETWGSLGHCHLMMDNLQEAYTSY
QQALYHLRDPKEPKLWYGIGILYDRYGSLDHAEEAFSQVMRMAPDFEKANEIYFRLGIIYKQQQKFNQSLECFKY
IVSDPPRPLTEEDIWFQIGHVHEQQKDFESAQSAYQRVLERDPNHAKVLQQLGWLYHQQSNAFQSQEKAIQFLEK
SVNADNNDAQSWYLLGRCYMSMAKYPKAYEAYQQAVYRDGRNPTFWCSIGVLYYQINQYRDALDAYSRAIRLNPY
ISEVWYDLGTLYESCNNQIADALDAYGRAADLDPSNVHIKARLQLLQSQLSAGTAGQQPPSAPAPQPQDVHPQAY
QAPGVGAPPAPQWGAPAPIGPPPQAPAPPRQIPDWNRGINELQSQNQAPPSNGLDQRDARIPGAPAQSPRQEPGR
SFPDPRGAPRSPKMGDPNSYPPPHTLPQLGNAPGPSHERAPSGSNAFGAPRGALPSGLPVAPPGPPGPPGPNGGA
PPPPYQNRPFSPAPEIRPIREERPSSPGSGYPLQQFHPGPTLPPQVPGGNSIASGAPAPASAATAAEAAARDRED
RPASAMKRGREWEADAGPVKKHANEESRARLDDQNNRRPSPPARLPSPGEMQRRSSSEARREDARRANENYHPSE
AAHHPPTLPSIQDMPPRPSAGPSLPPMAESSAPAPNAPPTGPPSANTPVKEEAPRPEAPPAHEPPARKMDVDEDY
DDEVEEEKKAAASKGSPNGSTAGNPANGAGNARASTPSKIEPTA*
Coding >Pro_DTO377G3_2|g9103.t1
ATGTCTCATACTCAACCATCGCCCACCACGGGCGTGGCTCCTCACCATGCCGCAGCGCATCTCGCTCATGCGCAA
GCGCAGGCGCAGGCCAATGGTCATATGTCCGCAATTCCCGTGCAAGGTCAAAAGGGAGTCCCTACTCTCACCACC
GCGCAAAAGATCGCCACACTCAATGAACAAGTCTGGCTTCAAATAGGAAGCTTGACCGAATTGATGGGCGATCTG
GAGGGTGCGATGAATGCCTACGAGCAGGCTCTGCGTCACAACCAGTGGTCTATCTCAGCGATGAATGCCATTTCA
TGCATTCTCCGGACAAAGGAGCAGTTTCCAAAAGCAATTGAGTACTTGCAAAATATTTTGAAGTTGGATCCGAGC
AATGGCGAGACTTGGGGCAGCCTGGGCCACTGCCATCTTATGATGGATAATTTACAAGAGGCATACACCTCTTAC
CAGCAAGCCCTTTACCACTTGCGTGACCCCAAAGAACCCAAGCTGTGGTATGGAATCGGTATATTGTATGATCGC
TATGGCTCTCTGGATCACGCGGAAGAGGCTTTCTCGCAAGTGATGCGCATGGCACCTGATTTCGAAAAGGCTAAT
GAGATCTACTTCCGCCTGGGAATCATATACAAGCAGCAGCAGAAGTTTAATCAGAGTTTGGAGTGCTTCAAATAC
ATTGTTAGCGATCCTCCACGCCCTCTGACCGAAGAAGACATCTGGTTCCAGATTGGCCATGTCCACGAGCAACAG
AAAGACTTTGAATCTGCCCAATCCGCGTACCAGCGCGTCCTGGAGCGAGATCCAAACCACGCCAAGGTTCTCCAG
CAACTTGGTTGGCTCTATCACCAGCAGAGTAATGCTTTCCAAAGCCAGGAGAAGGCCATTCAGTTCCTGGAAAAG
TCGGTCAATGCTGATAACAATGACGCTCAAAGCTGGTATCTCCTTGGTCGTTGCTACATGTCCATGGCGAAATAC
CCCAAGGCGTATGAAGCCTATCAGCAAGCGGTCTATCGCGACGGCCGCAACCCTACCTTCTGGTGCTCGATTGGT
GTTCTTTACTACCAGATCAACCAATATCGCGATGCCCTCGATGCTTACTCTCGTGCGATCCGCCTGAACCCTTAC
ATTTCAGAGGTCTGGTATGACCTGGGCACTTTGTACGAATCATGCAACAACCAGATTGCCGATGCTCTGGATGCC
TACGGACGCGCCGCAGATCTTGACCCGAGCAACGTTCACATCAAGGCTCGTCTGCAGCTTCTTCAAAGCCAGTTG
TCTGCTGGCACGGCTGGACAACAGCCACCTTCTGCCCCCGCGCCTCAGCCGCAGGATGTTCATCCTCAGGCTTAT
CAGGCACCTGGCGTTGGTGCACCTCCAGCTCCTCAGTGGGGTGCACCAGCCCCCATCGGTCCCCCTCCACAAGCT
CCTGCACCCCCGAGACAGATTCCTGACTGGAACCGTGGGATCAACGAGCTTCAGTCTCAAAATCAAGCTCCCCCA
TCTAACGGCCTTGACCAGCGCGACGCTCGGATCCCCGGTGCTCCCGCTCAAAGCCCTCGACAGGAGCCTGGTCGG
TCGTTCCCGGATCCCCGTGGCGCGCCTCGCTCGCCAAAGATGGGTGATCCCAACTCCTACCCGCCGCCTCACACT
CTACCCCAGCTTGGAAATGCGCCTGGTCCAAGCCACGAACGCGCTCCTAGTGGCAGCAATGCCTTTGGTGCTCCG
CGTGGTGCTCTGCCGAGTGGCCTGCCCGTCGCTCCTCCTGGTCCCCCTGGACCTCCTGGACCCAATGGCGGTGCT
CCTCCCCCTCCTTACCAGAACCGCCCTTTCAGTCCTGCTCCTGAGATTCGCCCTATTCGCGAGGAGCGTCCCTCT
TCGCCAGGTTCAGGATACCCCCTCCAACAGTTCCACCCCGGTCCTACCCTCCCCCCACAAGTTCCAGGTGGTAAC
TCCATCGCCTCTGGTGCCCCGGCCCCTGCTTCGGCTGCCACTGCTGCTGAGGCTGCCGCCCGTGATCGCGAAGAT
CGCCCCGCATCTGCAATGAAGCGCGGCCGCGAATGGGAAGCTGATGCTGGCCCAGTCAAGAAGCATGCAAATGAA
GAGAGCCGGGCTCGTCTGGATGACCAGAATAACCGCCGCCCGAGCCCACCCGCTCGTTTGCCTTCTCCTGGTGAG
ATGCAACGACGAAGCTCCTCAGAGGCCCGCCGCGAGGACGCCCGTCGTGCCAATGAGAACTATCACCCCTCAGAA
GCTGCTCACCACCCTCCTACTCTGCCTTCGATCCAAGACATGCCTCCCCGTCCTTCTGCTGGCCCCAGTCTTCCC
CCGATGGCCGAGAGCTCTGCACCTGCACCTAACGCTCCCCCCACTGGACCTCCTTCCGCCAACACCCCGGTCAAG
GAAGAAGCTCCTCGTCCTGAGGCTCCCCCTGCACACGAGCCCCCCGCGCGTAAGATGGATGTCGATGAAGACTAC
GATGATGAAGTTGAGGAAGAGAAGAAGGCTGCTGCTTCTAAGGGCAGCCCCAACGGCAGCACTGCTGGCAACCCC
GCCAATGGTGCTGGAAATGCCCGTGCCAGTACTCCATCCAAGATCGAGCCTACGGCATAA
Transcript >Pro_DTO377G3_2|g9103.t1
ATGTCTCATACTCAACCATCGCCCACCACGGGCGTGGCTCCTCACCATGCCGCAGCGCATCTCGCTCATGCGCAA
GCGCAGGCGCAGGCCAATGGTCATATGTCCGCAATTCCCGTGCAAGGTCAAAAGGGAGTCCCTACTCTCACCACC
GCGCAAAAGATCGCCACACTCAATGAACAAGTCTGGCTTCAAATAGGAAGCTTGACCGAATTGATGGGCGATCTG
GAGGGTGCGATGAATGCCTACGAGCAGGCTCTGCGTCACAACCAGTGGTCTATCTCAGCGATGAATGCCATTTCA
TGCATTCTCCGGACAAAGGAGCAGTTTCCAAAAGCAATTGAGTACTTGCAAAATATTTTGAAGTTGGATCCGAGC
AATGGCGAGACTTGGGGCAGCCTGGGCCACTGCCATCTTATGATGGATAATTTACAAGAGGCATACACCTCTTAC
CAGCAAGCCCTTTACCACTTGCGTGACCCCAAAGAACCCAAGCTGTGGTATGGAATCGGTATATTGTATGATCGC
TATGGCTCTCTGGATCACGCGGAAGAGGCTTTCTCGCAAGTGATGCGCATGGCACCTGATTTCGAAAAGGCTAAT
GAGATCTACTTCCGCCTGGGAATCATATACAAGCAGCAGCAGAAGTTTAATCAGAGTTTGGAGTGCTTCAAATAC
ATTGTTAGCGATCCTCCACGCCCTCTGACCGAAGAAGACATCTGGTTCCAGATTGGCCATGTCCACGAGCAACAG
AAAGACTTTGAATCTGCCCAATCCGCGTACCAGCGCGTCCTGGAGCGAGATCCAAACCACGCCAAGGTTCTCCAG
CAACTTGGTTGGCTCTATCACCAGCAGAGTAATGCTTTCCAAAGCCAGGAGAAGGCCATTCAGTTCCTGGAAAAG
TCGGTCAATGCTGATAACAATGACGCTCAAAGCTGGTATCTCCTTGGTCGTTGCTACATGTCCATGGCGAAATAC
CCCAAGGCGTATGAAGCCTATCAGCAAGCGGTCTATCGCGACGGCCGCAACCCTACCTTCTGGTGCTCGATTGGT
GTTCTTTACTACCAGATCAACCAATATCGCGATGCCCTCGATGCTTACTCTCGTGCGATCCGCCTGAACCCTTAC
ATTTCAGAGGTCTGGTATGACCTGGGCACTTTGTACGAATCATGCAACAACCAGATTGCCGATGCTCTGGATGCC
TACGGACGCGCCGCAGATCTTGACCCGAGCAACGTTCACATCAAGGCTCGTCTGCAGCTTCTTCAAAGCCAGTTG
TCTGCTGGCACGGCTGGACAACAGCCACCTTCTGCCCCCGCGCCTCAGCCGCAGGATGTTCATCCTCAGGCTTAT
CAGGCACCTGGCGTTGGTGCACCTCCAGCTCCTCAGTGGGGTGCACCAGCCCCCATCGGTCCCCCTCCACAAGCT
CCTGCACCCCCGAGACAGATTCCTGACTGGAACCGTGGGATCAACGAGCTTCAGTCTCAAAATCAAGCTCCCCCA
TCTAACGGCCTTGACCAGCGCGACGCTCGGATCCCCGGTGCTCCCGCTCAAAGCCCTCGACAGGAGCCTGGTCGG
TCGTTCCCGGATCCCCGTGGCGCGCCTCGCTCGCCAAAGATGGGTGATCCCAACTCCTACCCGCCGCCTCACACT
CTACCCCAGCTTGGAAATGCGCCTGGTCCAAGCCACGAACGCGCTCCTAGTGGCAGCAATGCCTTTGGTGCTCCG
CGTGGTGCTCTGCCGAGTGGCCTGCCCGTCGCTCCTCCTGGTCCCCCTGGACCTCCTGGACCCAATGGCGGTGCT
CCTCCCCCTCCTTACCAGAACCGCCCTTTCAGTCCTGCTCCTGAGATTCGCCCTATTCGCGAGGAGCGTCCCTCT
TCGCCAGGTTCAGGATACCCCCTCCAACAGTTCCACCCCGGTCCTACCCTCCCCCCACAAGTTCCAGGTGGTAAC
TCCATCGCCTCTGGTGCCCCGGCCCCTGCTTCGGCTGCCACTGCTGCTGAGGCTGCCGCCCGTGATCGCGAAGAT
CGCCCCGCATCTGCAATGAAGCGCGGCCGCGAATGGGAAGCTGATGCTGGCCCAGTCAAGAAGCATGCAAATGAA
GAGAGCCGGGCTCGTCTGGATGACCAGAATAACCGCCGCCCGAGCCCACCCGCTCGTTTGCCTTCTCCTGGTGAG
ATGCAACGACGAAGCTCCTCAGAGGCCCGCCGCGAGGACGCCCGTCGTGCCAATGAGAACTATCACCCCTCAGAA
GCTGCTCACCACCCTCCTACTCTGCCTTCGATCCAAGACATGCCTCCCCGTCCTTCTGCTGGCCCCAGTCTTCCC
CCGATGGCCGAGAGCTCTGCACCTGCACCTAACGCTCCCCCCACTGGACCTCCTTCCGCCAACACCCCGGTCAAG
GAAGAAGCTCCTCGTCCTGAGGCTCCCCCTGCACACGAGCCCCCCGCGCGTAAGATGGATGTCGATGAAGACTAC
GATGATGAAGTTGAGGAAGAGAAGAAGGCTGCTGCTTCTAAGGGCAGCCCCAACGGCAGCACTGCTGGCAACCCC
GCCAATGGTGCTGGAAATGCCCGTGCCAGTACTCCATCCAAGATCGAGCCTACGGCATAA
Gene >Pro_DTO377G3_2|g9103.t1
ATGTCTCATACTCAACCATCGCCCACCACGGGCGTGGCTCCTCACCATGCCGCAGCGCATCTCGCTCATGCGCAA
GCGCAGGCGCAGGCCAATGGTCATATGTCCGCAATTCCCGTGCAAGGTCAAAAGGGAGTCCCTACTCTCACCACC
GCGCAAAAGATCGCCACACTCAATGAACAAGTCTGGCTTCAAATAGGTAAATATTCCCGATCATTATAATTTGGC
GAATCCTGACAGCCTCGTTTGTAGGAAGCTTGACCGAATTGATGGGCGATCTGGAGGGTGCGATGAATGCCTACG
AGCAGGCTCTGCGTCACAACCAGTGGTCTATCTCAGCGATGAATGCCATTTCATGCATTCTCCGGACAAAGGAGC
AGTTTCCAAAAGCAATTGAGTACTTGCAAAATATTTTGAAGTTGGATCCGAGCAATGGCGAGACTTGGGGCAGCC
TGGGCCACTGCCATCTTATGATGGATAATTTACAAGAGGCATACACCTCTTACCAGCAAGCCCTTTACCACTTGC
GTGACCCCAAAGTAAGCCGTTTTCCCTTAACATTTTCCCTCGAATATTTCTCTGATTCAATTCTCTCATTAGGAA
CCCAAGCTGTGGTATGGAATCGGTATATTGTATGATCGCTATGGCTCTCTGGATCACGCGGAAGAGGCTTTCTCG
CAAGTGATGCGCATGGCACCTGATTTCGAAAAGGCTAATGAGATCTACTTCCGCCTGGGAATCATATACAAGCAG
CAGCAGAAGTTTAATCAGAGTTTGGAGGTATGTGAAATCTCTTCATATGAGCGAGAGCTGTCACTAACTCATCCT
AGTGCTTCAAATACATTGTTAGCGATCCTCCACGCCCTCTGACCGAAGAAGACATCTGGTTCCAGATTGGCCATG
TCCACGAGCAACAGAAAGACGTAAGTCATGCTTCCCTACACTCTTGATTACCTTGTACTCATTCAATCCTCAGTT
TGAATCTGCCCAATCCGCGTACCAGCGCGTCCTGGAGCGAGATCCAAACCACGCCAAGGTTCTCCAGCAACTTGG
TTGGCTCTATCACCAGCAGAGTAATGCTTTCCAAAGCCAGGAGAAGGCCATTCAGTTCCTGGAAAAGTCGGTCAA
TGCTGGTAAGTCACAATCCCCAGGACTATATACATTTGAAACTAATTCATCCTTTCCCTAGATAACAATGACGCT
CAAAGCTGGTATCTCCTTGGTCGTTGCTACATGTCCATGGCGAAATACCCCAAGGCGTATGAAGCCTATCAGCAA
GCGGTCTATCGCGACGGCCGCAACCCTACCTTCTGGTGCTCGATTGGTGTTCTTTACTACCAGATCAACCAATAT
CGCGATGCCCTCGATGCTTACTCTCGTGCGATCCGCCTGAACCCTTACATTTCAGAGGTCTGGTATGACCTGGGC
ACTTTGTACGAATCATGCAACAACCAGATTGCCGATGCTCTGGATGCCTACGGACGCGCCGCAGATCTTGACCCG
AGCAACGTTCACATCAAGGCTCGTCTGCAGCTTCTTCAAAGCCAGTTGTCTGCTGGCACGGCTGGACAACAGCCA
CCTTCTGCCCCCGCGCCTCAGCCGCAGGATGTTCATCCTCAGGCTTATCAGGCACCTGGCGTTGGTGCACCTCCA
GCTCCTCAGTGGGGTGCACCAGCCCCCATCGGTCCCCCTCCACAAGCTCCTGCACCCCCGAGACAGATTCCTGAC
TGGAACCGTGGGATCAACGAGCTTCAGTCTCAAAATCAAGCTCCCCCATCTAACGGCCTTGACCAGCGCGACGCT
CGGATCCCCGGTGCTCCCGCTCAAAGCCCTCGACAGGAGCCTGGTCGGTCGTTCCCGGATCCCCGTGGCGCGCCT
CGCTCGCCAAAGATGGGTGATCCCAACTCCTACCCGCCGCCTCACACTCTACCCCAGCTTGGAAATGCGCCTGGT
CCAAGCCACGAACGCGCTCCTAGTGGCAGCAATGCCTTTGGTGCTCCGCGTGGTGCTCTGCCGAGTGGCCTGCCC
GTCGCTCCTCCTGGTCCCCCTGGACCTCCTGGACCCAATGGCGGTGCTCCTCCCCCTCCTTACCAGAACCGCCCT
TTCAGTCCTGCTCCTGAGATTCGCCCTATTCGCGAGGAGCGTCCCTCTTCGCCAGGTTCAGGATACCCCCTCCAA
CAGTTCCACCCCGGTCCTACCCTCCCCCCACAAGTTCCAGGTGGTAACTCCATCGCCTCTGGTGCCCCGGCCCCT
GCTTCGGCTGCCACTGCTGCTGAGGCTGCCGCCCGTGATCGCGAAGATCGCCCCGCATCTGCAATGAAGCGCGGC
CGCGAATGGGAAGCTGATGCTGGCCCAGTCAAGAAGCATGCAAATGAAGAGAGCCGGGCTCGTCTGGATGACCAG
AATAACCGCCGCCCGAGCCCACCCGCTCGTTTGCCTTCTCCTGGTGAGATGCAACGACGAAGCTCCTCAGAGGCC
CGCCGCGAGGACGCCCGTCGTGCCAATGAGAACTATCACCCCTCAGAAGCTGCTCACCACCCTCCTACTCTGCCT
TCGATCCAAGACATGCCTCCCCGTCCTTCTGCTGGCCCCAGTCTTCCCCCGATGGCCGAGAGCTCTGCACCTGCA
CCTAACGCTCCCCCCACTGGACCTCCTTCCGCCAACACCCCGGTCAAGGAAGAAGCTCCTCGTCCTGAGGCTCCC
CCTGCACACGAGCCCCCCGCGCGTAAGATGGATGTCGATGAAGACTACGATGATGAAGTTGAGGAAGAGAAGAAG
GCTGCTGCTTCTAAGGGCAGCCCCAACGGCAGCACTGCTGGCAACCCCGCCAATGGTGCTGGAAATGCCCGTGCC
AGTACTCCATCCAAGATCGAGCCTACGGCATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail