Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g9102.t1
Gene name
Locationscaffold_41:125691..126703
Strand-
Gene length (bp)1012
Transcript length (bp)960
Coding sequence length (bp)960
Protein length (aa) 320

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 63 0.45

Transmembrane Domains

Domain # Start End Length
1 153 175 22
2 256 278 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 37.94 19.48 56.40
5d_25C Five days - 25 degrees Celsius 36.19 18.51 53.87
7d_25C Seven days - 25 degrees Celsius 40.25 21.16 59.33
10d_25C Ten days - 25 degrees Celsius 51.43 28.36 74.49
7d_15C Seven days - 15 degrees Celsius 46.76 25.25 68.26
7d_30C Seven days - 30 degrees Celsius 48.86 26.72 71.00

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.908978 no
3d_25C 7d_25C 0.881239 no
3d_25C 7d_15C 0.503412 no
3d_25C 7d_30C 0.389919 no
3d_25C 10d_25C 0.283229 no
5d_25C 7d_25C 0.768951 no
5d_25C 7d_15C 0.391222 no
5d_25C 7d_30C 0.286862 no
5d_25C 10d_25C 0.195146 no
7d_25C 7d_15C 0.652739 no
7d_25C 7d_30C 0.528087 no
7d_25C 10d_25C 0.406281 no
7d_15C 7d_30C 0.911547 no
7d_15C 10d_25C 0.784217 no
7d_30C 10d_25C 0.888456 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g9102.t1
MRSPEMSYSPAYYHDQGPNPRSSIVTPPPATRHSQEQSSVLGHPVGESRTSSPIPSRDASPRTSGSRQHRVYHTQ
TLGGTAWPGSDARDGGSTLSGAHKEERATSSWADQPSVMSGELSNPSITRVRKRPISNVEIITNEGQDALLMLFR
LTIIPFYSLGATLYTIFALLFALFVSPFRLCSFSPYLCATTFASQLCDLLSPILHIHERLVCLQPPSVEDRSSST
QSTQWIRSEPDSDQPSVLSEPSEVYAVTSSIFVLLLSPLLSIVILLFAWTAAFFWVFSMVLGNPDGTERKDDGRT
AVLGVCKWWRSWLCRARKS*
Coding >Pro_DTO377G3_2|g9102.t1
ATGCGGTCCCCGGAGATGTCATATAGTCCCGCCTACTATCACGATCAAGGACCAAACCCTCGCAGCTCGATTGTT
ACCCCACCTCCGGCTACCCGTCATTCCCAAGAACAGTCCTCCGTATTGGGTCACCCTGTAGGCGAATCTCGAACC
TCCTCTCCTATACCAAGCCGCGATGCCAGTCCCCGCACCTCCGGATCACGGCAACACCGTGTGTACCATACTCAG
ACACTGGGAGGAACTGCCTGGCCCGGCTCAGATGCTCGGGATGGCGGCTCGACATTAAGTGGTGCACACAAGGAA
GAGCGGGCGACAAGCAGCTGGGCAGACCAGCCGTCAGTAATGTCGGGGGAACTTTCCAACCCGAGCATAACCCGT
GTCCGAAAACGACCCATTTCGAATGTTGAGATAATCACCAATGAGGGCCAGGATGCTCTTCTAATGCTGTTCCGT
CTCACTATCATCCCATTCTACTCACTCGGCGCTACTCTATACACTATATTCGCCCTCCTCTTCGCACTCTTTGTT
TCACCTTTCCGCCTCTGCTCATTTTCTCCATACCTCTGCGCAACGACGTTCGCATCACAACTTTGCGATCTCCTT
TCTCCTATCCTCCACATCCACGAACGGCTCGTTTGCTTGCAGCCACCATCAGTGGAAGACCGATCGTCATCGACC
CAATCGACCCAATGGATCCGCTCAGAGCCAGATTCAGACCAGCCGTCAGTGCTATCCGAGCCGAGCGAGGTCTAT
GCCGTGACTAGTTCAATCTTCGTACTGCTCTTATCCCCGTTACTCAGCATTGTGATCCTCCTCTTCGCATGGACA
GCCGCATTTTTCTGGGTCTTCTCCATGGTCCTAGGTAACCCGGACGGCACCGAGCGAAAGGACGACGGCCGCACC
GCCGTTCTCGGAGTTTGCAAATGGTGGCGGTCATGGCTCTGCAGAGCCCGGAAGTCATAA
Transcript >Pro_DTO377G3_2|g9102.t1
ATGCGGTCCCCGGAGATGTCATATAGTCCCGCCTACTATCACGATCAAGGACCAAACCCTCGCAGCTCGATTGTT
ACCCCACCTCCGGCTACCCGTCATTCCCAAGAACAGTCCTCCGTATTGGGTCACCCTGTAGGCGAATCTCGAACC
TCCTCTCCTATACCAAGCCGCGATGCCAGTCCCCGCACCTCCGGATCACGGCAACACCGTGTGTACCATACTCAG
ACACTGGGAGGAACTGCCTGGCCCGGCTCAGATGCTCGGGATGGCGGCTCGACATTAAGTGGTGCACACAAGGAA
GAGCGGGCGACAAGCAGCTGGGCAGACCAGCCGTCAGTAATGTCGGGGGAACTTTCCAACCCGAGCATAACCCGT
GTCCGAAAACGACCCATTTCGAATGTTGAGATAATCACCAATGAGGGCCAGGATGCTCTTCTAATGCTGTTCCGT
CTCACTATCATCCCATTCTACTCACTCGGCGCTACTCTATACACTATATTCGCCCTCCTCTTCGCACTCTTTGTT
TCACCTTTCCGCCTCTGCTCATTTTCTCCATACCTCTGCGCAACGACGTTCGCATCACAACTTTGCGATCTCCTT
TCTCCTATCCTCCACATCCACGAACGGCTCGTTTGCTTGCAGCCACCATCAGTGGAAGACCGATCGTCATCGACC
CAATCGACCCAATGGATCCGCTCAGAGCCAGATTCAGACCAGCCGTCAGTGCTATCCGAGCCGAGCGAGGTCTAT
GCCGTGACTAGTTCAATCTTCGTACTGCTCTTATCCCCGTTACTCAGCATTGTGATCCTCCTCTTCGCATGGACA
GCCGCATTTTTCTGGGTCTTCTCCATGGTCCTAGGTAACCCGGACGGCACCGAGCGAAAGGACGACGGCCGCACC
GCCGTTCTCGGAGTTTGCAAATGGTGGCGGTCATGGCTCTGCAGAGCCCGGAAGTCATAA
Gene >Pro_DTO377G3_2|g9102.t1
ATGCGGTCCCCGGAGATGTCATATAGTCCCGCCTACTATCACGATCAAGGACCAAACCCTCGCAGCTCGATTGTT
ACCCCACCTCCGGCTACCCGTCATTCCCAAGAACAGTCCTCCGTATTGGGTCACCCTGTAGGCGAATCTCGAACC
TCCTCTCCTATACCAAGCCGCGATGCCAGTCCCCGCACCTCCGGATCACGGCAACACCGTGTGTACCATACTCAG
ACACTGGGAGGAACTGCCTGGCCCGGCTCAGATGCTCGGGATGGCGGCTCGACATTAAGTGGTGCACACAAGGAA
GAGCGGGCGACAAGCAGCTGGGCAGACCAGCCGTCAGTAATGTCGGGGGAACTTTCCAACCCGAGCATAACCCGT
GTCCGAAAACGACCCATTTCGAATGTTGAGATAATCACCAATGAGGGCCAGGATGCTCTTCTAATGCTGGTACGT
GCGCAATATAGCGGTCTAATACTTCTATGCTAATACAAACTGGCAGTTCCGTCTCACTATCATCCCATTCTACTC
ACTCGGCGCTACTCTATACACTATATTCGCCCTCCTCTTCGCACTCTTTGTTTCACCTTTCCGCCTCTGCTCATT
TTCTCCATACCTCTGCGCAACGACGTTCGCATCACAACTTTGCGATCTCCTTTCTCCTATCCTCCACATCCACGA
ACGGCTCGTTTGCTTGCAGCCACCATCAGTGGAAGACCGATCGTCATCGACCCAATCGACCCAATGGATCCGCTC
AGAGCCAGATTCAGACCAGCCGTCAGTGCTATCCGAGCCGAGCGAGGTCTATGCCGTGACTAGTTCAATCTTCGT
ACTGCTCTTATCCCCGTTACTCAGCATTGTGATCCTCCTCTTCGCATGGACAGCCGCATTTTTCTGGGTCTTCTC
CATGGTCCTAGGTAACCCGGACGGCACCGAGCGAAAGGACGACGGCCGCACCGCCGTTCTCGGAGTTTGCAAATG
GTGGCGGTCATGGCTCTGCAGAGCCCGGAAGTCATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail