Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g908.t1
Gene name
Locationscaffold_01:2412850..2413381
Strand-
Gene length (bp)531
Transcript length (bp)225
Coding sequence length (bp)225
Protein length (aa) 75

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07225 NDUF_B4 NADH-ubiquinone oxidoreductase B15 subunit (NDUFB4) 9.1E-06 4 57

GO

GO Term Description Terminal node
GO:0008137 NADH dehydrogenase (ubiquinone) activity Yes
GO:0005739 mitochondrion Yes
GO:0044464 cell part No
GO:0043231 intracellular membrane-bounded organelle No
GO:0050136 NADH dehydrogenase (quinone) activity No
GO:0003674 molecular_function No
GO:0043226 organelle No
GO:0016655 oxidoreductase activity, acting on NAD(P)H, quinone or similar compound as acceptor No
GO:0003954 NADH dehydrogenase activity No
GO:0043227 membrane-bounded organelle No
GO:0043229 intracellular organelle No
GO:0005575 cellular_component No
GO:0016651 oxidoreductase activity, acting on NAD(P)H No
GO:0003824 catalytic activity No
GO:0016491 oxidoreductase activity No
GO:0044424 intracellular part No
GO:0044444 cytoplasmic part No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.5

Transmembrane Domains

Domain # Start End Length
1 35 54 19

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g908.t1
MAGHNKSVILDPALQRYYELNINRYKYWRWTPRQAWISFVYAGLIPGILGYFAYKTDGKFEFRGKRRGDSIAEW*
Coding >Pro_DTO377G3_2|g908.t1
ATGGCTGGCCATAACAAGTCCGTGATCCTTGACCCGGCCCTCCAGAGATACTATGAACTCAATATCAACCGCTAC
AAGTACTGGCGCTGGACCCCGCGTCAGGCCTGGATCTCATTCGTCTACGCCGGCCTGATCCCCGGCATCCTAGGA
TACTTCGCCTACAAGACCGATGGCAAGTTCGAGTTCCGTGGCAAGCGCAGAGGAGATTCCATCGCCGAATGGTAG
Transcript >Pro_DTO377G3_2|g908.t1
ATGGCTGGCCATAACAAGTCCGTGATCCTTGACCCGGCCCTCCAGAGATACTATGAACTCAATATCAACCGCTAC
AAGTACTGGCGCTGGACCCCGCGTCAGGCCTGGATCTCATTCGTCTACGCCGGCCTGATCCCCGGCATCCTAGGA
TACTTCGCCTACAAGACCGATGGCAAGTTCGAGTTCCGTGGCAAGCGCAGAGGAGATTCCATCGCCGAATGGTAG
Gene >Pro_DTO377G3_2|g908.t1
ATGGCTGGCCATAACAAGTGTGAGCTTTCAGAAATTGACGAATCCTGCGACCTGATTTGCTAATAATTGTCCCAG
CCGTGATCCTTGACCCGGCCCTCCAGAGATACTATGGTACATACCCCCAACCCCATCTCCTACGATCCAGGACCC
CGGACGAGCCTCGCGAATCACGCTAGCTTAACCATACCCGAGCTACTGGAGCATCTCTCTCAAAACCAGCATGCC
GCGACACGATATATCTACAATTGAAGATTGACTAACGGACCCGCAGAACTCAATATCAACCGCTACAAGTACTGG
CGCTGGACCCCGCGTCAGGCCTGGATCTCATTCGTCTACGCCGGCCTGATCCCCGGCATCCTAGGATACTTCGCC
TACAAGACCGATGTATGGAATCCCGCATTGTTGAATTGGATTGCAATTGCACATTGTGGTCTGATCTTGCGGAGA
GAGAAACACGCGCTAACGATATCGCAGGGCAAGTTCGAGTTCCGTGGCAAGCGCAGAGGAGATTCCATCGCCGAA
TGGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail