Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g9075.t1
Gene name
Locationscaffold_41:65385..66660
Strand-
Gene length (bp)1275
Transcript length (bp)825
Coding sequence length (bp)825
Protein length (aa) 275

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01267 F-actin_cap_A F-actin capping protein alpha subunit 2.2E-94 8 269

GO

GO Term Description Terminal node
GO:0008290 F-actin capping protein complex Yes
GO:0051016 barbed-end actin filament capping Yes
GO:0043242 negative regulation of protein complex disassembly No
GO:0051493 regulation of cytoskeleton organization No
GO:0008064 regulation of actin polymerization or depolymerization No
GO:0030833 regulation of actin filament polymerization No
GO:0044446 intracellular organelle part No
GO:0050794 regulation of cellular process No
GO:0051693 actin filament capping No
GO:0065008 regulation of biological quality No
GO:1901879 regulation of protein depolymerization No
GO:0043244 regulation of protein complex disassembly No
GO:0010639 negative regulation of organelle organization No
GO:0032956 regulation of actin cytoskeleton organization No
GO:0032970 regulation of actin filament-based process No
GO:0065007 biological regulation No
GO:1902904 negative regulation of supramolecular fiber organization No
GO:0016043 cellular component organization No
GO:0032272 negative regulation of protein polymerization No
GO:0032271 regulation of protein polymerization No
GO:0030832 regulation of actin filament length No
GO:0050789 regulation of biological process No
GO:0044464 cell part No
GO:0030834 regulation of actin filament depolymerization No
GO:0043254 regulation of protein complex assembly No
GO:0051129 negative regulation of cellular component organization No
GO:0048519 negative regulation of biological process No
GO:0071840 cellular component organization or biogenesis No
GO:1901880 negative regulation of protein depolymerization No
GO:0044424 intracellular part No
GO:1902903 regulation of supramolecular fiber organization No
GO:0044422 organelle part No
GO:0031333 negative regulation of protein complex assembly No
GO:0044087 regulation of cellular component biogenesis No
GO:0008150 biological_process No
GO:0090066 regulation of anatomical structure size No
GO:0044430 cytoskeletal part No
GO:0051128 regulation of cellular component organization No
GO:0030837 negative regulation of actin filament polymerization No
GO:0033043 regulation of organelle organization No
GO:0005575 cellular_component No
GO:0032991 protein-containing complex No
GO:0110053 regulation of actin filament organization No
GO:0048523 negative regulation of cellular process No
GO:0030835 negative regulation of actin filament depolymerization No
GO:0051494 negative regulation of cytoskeleton organization No
GO:0009987 cellular process No
GO:0032535 regulation of cellular component size No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 22 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g9075.t1
MASTVELASSFIEGAPPGELADVVADVQALTSEGEDIIPSLLPAFKRYNEAQLATVKLPGSSQEVIVSEFNELED
NRYFDPESQTSFEIDHTTQTASAAQSYALESEHADLIKSLLKSFGVHAREHYPNCSYGVYPIENDSAVAIVLVAN
RYSPNNFWNGRFRAIYQLPVSSSSSTLTGNIHVDVHYYEDGNVALNTTKPISIPIPSVSAESIVSRIAAAERDYQ
EALNRAFVQTSEGVFKGLRRQLPITRQKVEWEKVGGYRLGQDISGGKGR*
Coding >Pro_DTO377G3_2|g9075.t1
ATGGCTTCCACTGTTGAATTGGCATCCTCCTTCATCGAGGGTGCCCCGCCAGGAGAGCTCGCAGATGTTGTCGCC
GATGTGCAAGCCTTAACTTCCGAGGGCGAGGATATCATTCCTTCTCTTCTACCCGCATTCAAACGGTACAACGAG
GCGCAGCTCGCAACGGTGAAATTGCCAGGATCAAGTCAGGAGGTCATTGTTAGTGAATTTAACGAGCTCGAAGAC
AACCGCTACTTCGACCCTGAGAGCCAAACCTCGTTTGAGATCGACCACACCACACAGACAGCCTCGGCAGCACAA
TCATACGCATTGGAGTCAGAGCACGCCGACTTGATCAAATCGCTACTCAAGTCGTTCGGTGTTCATGCCCGCGAA
CACTACCCCAACTGCTCGTATGGTGTCTACCCTATTGAGAATGACTCTGCCGTCGCCATCGTCTTGGTCGCCAAC
CGATACTCCCCCAACAACTTCTGGAATGGTCGTTTCCGCGCAATTTACCAACTCCCCGTCTCCTCCTCGTCCTCT
ACCCTGACTGGCAACATCCACGTTGACGTGCACTACTACGAAGATGGCAATGTGGCCCTCAATACTACTAAGCCT
ATCAGCATTCCCATCCCTTCCGTGTCCGCCGAGTCGATTGTTTCACGGATTGCTGCGGCCGAGCGCGATTACCAG
GAAGCGCTGAATCGGGCGTTTGTTCAGACATCCGAGGGCGTATTCAAGGGTCTCCGGAGGCAGCTTCCCATTACA
CGACAGAAAGTGGAGTGGGAGAAGGTTGGTGGATATCGTCTGGGTCAGGATATCTCGGGCGGCAAAGGACGGTAG
Transcript >Pro_DTO377G3_2|g9075.t1
ATGGCTTCCACTGTTGAATTGGCATCCTCCTTCATCGAGGGTGCCCCGCCAGGAGAGCTCGCAGATGTTGTCGCC
GATGTGCAAGCCTTAACTTCCGAGGGCGAGGATATCATTCCTTCTCTTCTACCCGCATTCAAACGGTACAACGAG
GCGCAGCTCGCAACGGTGAAATTGCCAGGATCAAGTCAGGAGGTCATTGTTAGTGAATTTAACGAGCTCGAAGAC
AACCGCTACTTCGACCCTGAGAGCCAAACCTCGTTTGAGATCGACCACACCACACAGACAGCCTCGGCAGCACAA
TCATACGCATTGGAGTCAGAGCACGCCGACTTGATCAAATCGCTACTCAAGTCGTTCGGTGTTCATGCCCGCGAA
CACTACCCCAACTGCTCGTATGGTGTCTACCCTATTGAGAATGACTCTGCCGTCGCCATCGTCTTGGTCGCCAAC
CGATACTCCCCCAACAACTTCTGGAATGGTCGTTTCCGCGCAATTTACCAACTCCCCGTCTCCTCCTCGTCCTCT
ACCCTGACTGGCAACATCCACGTTGACGTGCACTACTACGAAGATGGCAATGTGGCCCTCAATACTACTAAGCCT
ATCAGCATTCCCATCCCTTCCGTGTCCGCCGAGTCGATTGTTTCACGGATTGCTGCGGCCGAGCGCGATTACCAG
GAAGCGCTGAATCGGGCGTTTGTTCAGACATCCGAGGGCGTATTCAAGGGTCTCCGGAGGCAGCTTCCCATTACA
CGACAGAAAGTGGAGTGGGAGAAGGTTGGTGGATATCGTCTGGGTCAGGATATCTCGGGCGGCAAAGGACGGTAG
Gene >Pro_DTO377G3_2|g9075.t1
ATGGCTTCCACTGTTGAATTGGCATCCTCCTTCATCGAGGGTGCCCCGCCAGGAGAGGTATGCACAACAATGATC
CAGGATCCCCCACTCCCCTGGTCAACGTCTGCCTGAAGCTTGGGAATGATCACTGACATGTTTTCTTCAGCTCGC
AGATGTTGTCGCCGGTAAATCGCCCTCTTAGCCCTACGCTGCCTATCCCGATCCCCGCAATCCCGGCATCTACAT
GGACGGTGCTAATCCCTACTACTTGATTAGATGTGCAAGCCTTAACTTCCGAGGGCGAGGATATCATTCCTTCTC
TTCTACCCGCATTCAAACGGTACAACGAGGCGCAGCTCGCAACGGTGAAATTGCCAGGATCAAGTCAGGAGGTGG
GTGTCGCTTGGGAGTCAACTATGTCTGCGGTGGAGCTAATAAGTTTGCTGGGAAGGTCATTGTTAGTGAATTTAA
CGAGCTCGAAGACAACCGCTACTTCGACCCTGAGAGCCAAACCTCGTTTGAGATCGACCACACCACACAGGTAGG
TTTCGCCTGACCAACTGGGCTGATACATTGAAGGCTTACGGGTTTGCACCATGGCAATAGACAGCCTCGGCAGCA
CAATCATACGCATTGGAGTCAGAGCACGCCGACTTGATGTAAGGAATGATCCCGGCTGAAGTCTTGGTGGTACTC
CGCTTACCGTGTTTAGCAAATCGCTACTCAAGTCGTTCGGTGTTCATGCCCGCGAACACTACCCCAACTGCTCGT
ATGGTGTCTACCCTATTGAGAATGACTCTGCCGTCGCCATCGTCTTGGTCGCCAACCGATACTCCCCCAACAACT
TCTGGTGGGTGGTTACATCTCTACAATTAATATCTTGGGAAGCTAATCGTTATGGACGCTTCCCCTTCTGGGGAG
GATTGTCTGTTCTAGGACAATAGGAATGGTCGTTTCCGCGCAATTTACCAACTCCCCGTCTCCTCCTCGTCCTCT
ACCCTGACTGGCAACATCCACGTTGACGTGCACTACTACGAAGATGGCAATGTGGCCCTCAATACTACTAAGCCT
ATCAGCATTCCCATCCCTTCCGTGTCCGCCGAGTCGATTGTTTCACGGATTGCTGCGGCCGAGCGCGATTACCAG
GAAGCGCTGAATCGGGCGTTTGTTCAGACATCCGAGGGCGTATTCAAGGGTCTCCGGAGGCAGCTTCCCATTACA
CGACAGAAAGTGGAGTGGGAGAAGGTTGGTGGATATCGTCTGGGTCAGGATATCTCGGGCGGCAAAGGACGGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail