Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g9074.t1
Gene name
Locationscaffold_41:64156..64955
Strand-
Gene length (bp)799
Transcript length (bp)672
Coding sequence length (bp)672
Protein length (aa) 224

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05648 PEX11 Peroxisomal biogenesis factor 11 (PEX11) 1.3E-37 3 220

GO

GO Term Description Terminal node
GO:0005779 integral component of peroxisomal membrane Yes
GO:0016559 peroxisome fission Yes
GO:0008150 biological_process No
GO:0031300 intrinsic component of organelle membrane No
GO:0016021 integral component of membrane No
GO:0009987 cellular process No
GO:0006996 organelle organization No
GO:0016043 cellular component organization No
GO:0031231 intrinsic component of peroxisomal membrane No
GO:0031224 intrinsic component of membrane No
GO:0110165 cellular anatomical entity No
GO:0048285 organelle fission No
GO:0071840 cellular component organization or biogenesis No
GO:0005575 cellular_component No
GO:0031301 integral component of organelle membrane No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 31 0.5

Transmembrane Domains

Domain # Start End Length
1 76 98 22
2 124 146 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g9074.t1
MIQHFSRFVKSGAGLEKTLRLIQCVSQVVAALTVSNVLAVQLTTVKLQLALTRRYFRFFGFIDSFQRMLALLGKD
GFGSVAGLLELAKCTCFGLYFVLEDLTTLHAMGVYAVTWNDPVMNQANTFWLYALSFSVAEAIWALLVSPAEQPS
KKNGKRKNRKIASEKTPVKSTVTSARVKQIVVDGCDLLIPLELLGWMPTGDVVVGSTMVLSTLLTAQEVWARV*
Coding >Pro_DTO377G3_2|g9074.t1
ATGATCCAACACTTTTCTCGCTTTGTCAAATCGGGCGCTGGTCTTGAAAAGACCCTTCGTCTGATCCAATGCGTG
TCGCAGGTGGTCGCAGCACTCACCGTGAGCAATGTCCTGGCCGTGCAATTGACCACGGTCAAGCTGCAATTGGCA
CTGACGCGGAGATATTTCCGCTTCTTTGGGTTCATTGACTCCTTCCAGCGGATGTTGGCGTTGCTGGGCAAGGAT
GGCTTCGGTTCTGTGGCTGGACTGCTTGAACTAGCCAAATGCACTTGCTTTGGCCTATACTTTGTCCTGGAAGAC
CTGACCACGCTTCATGCAATGGGCGTCTACGCAGTGACCTGGAATGATCCTGTCATGAACCAAGCCAATACGTTT
TGGTTATATGCGCTCTCTTTCTCTGTTGCAGAAGCCATTTGGGCACTGCTTGTCAGTCCCGCGGAGCAGCCTTCT
AAGAAGAATGGCAAGAGAAAGAACCGGAAGATCGCTTCCGAGAAGACCCCGGTAAAATCAACTGTTACCTCTGCC
CGGGTCAAGCAGATCGTGGTAGATGGCTGTGATTTGCTCATCCCGTTGGAGCTTTTGGGCTGGATGCCCACCGGG
GACGTGGTGGTTGGATCGACCATGGTTTTGAGTACACTGCTGACGGCTCAAGAGGTTTGGGCCCGAGTGTGA
Transcript >Pro_DTO377G3_2|g9074.t1
ATGATCCAACACTTTTCTCGCTTTGTCAAATCGGGCGCTGGTCTTGAAAAGACCCTTCGTCTGATCCAATGCGTG
TCGCAGGTGGTCGCAGCACTCACCGTGAGCAATGTCCTGGCCGTGCAATTGACCACGGTCAAGCTGCAATTGGCA
CTGACGCGGAGATATTTCCGCTTCTTTGGGTTCATTGACTCCTTCCAGCGGATGTTGGCGTTGCTGGGCAAGGAT
GGCTTCGGTTCTGTGGCTGGACTGCTTGAACTAGCCAAATGCACTTGCTTTGGCCTATACTTTGTCCTGGAAGAC
CTGACCACGCTTCATGCAATGGGCGTCTACGCAGTGACCTGGAATGATCCTGTCATGAACCAAGCCAATACGTTT
TGGTTATATGCGCTCTCTTTCTCTGTTGCAGAAGCCATTTGGGCACTGCTTGTCAGTCCCGCGGAGCAGCCTTCT
AAGAAGAATGGCAAGAGAAAGAACCGGAAGATCGCTTCCGAGAAGACCCCGGTAAAATCAACTGTTACCTCTGCC
CGGGTCAAGCAGATCGTGGTAGATGGCTGTGATTTGCTCATCCCGTTGGAGCTTTTGGGCTGGATGCCCACCGGG
GACGTGGTGGTTGGATCGACCATGGTTTTGAGTACACTGCTGACGGCTCAAGAGGTTTGGGCCCGAGTGTGA
Gene >Pro_DTO377G3_2|g9074.t1
ATGATCCAACACTTTTCTCGCTTTGTCAAATCGGGCGCTGGTCTTGAAAAGACCCTTCGTCTGATCCAATGCGTG
TCGCAGGTGGTCGCAGCACTCACCGTGAGCAATGTCCTGGCCGTGCAATTGACCACGGTCAAGCTGCAATTGGCA
CTGAGTAAGTTGAATTCTATATTGGATTGATAGATATATACTGTTATATATACTGATACTGGGTTTGTTGCGTAG
CGCGGAGATATTTCCGCTTCTTTGGGTTCATTGACTCCTTCCAGCGGATGTTGGCGTTGCTGGGCAAGGATGGCT
TCGGTTCTGTGGCTGGACTGCTTGAACTAGCCAAATGCACTTGCTTTGGCCTATACTTTGTCCTGGAAGACCTGA
CCACGGTATGTTATTTACTGCTGTTCCTTCTTCCTCCGTGAATAGGACTGACGAAGGCTAGCTTCATGCAATGGG
CGTCTACGCAGTGACCTGGAATGATCCTGTCATGAACCAAGCCAATACGTTTTGGTTATATGCGCTCTCTTTCTC
TGTTGCAGAAGCCATTTGGGCACTGCTTGTCAGTCCCGCGGAGCAGCCTTCTAAGAAGAATGGCAAGAGAAAGAA
CCGGAAGATCGCTTCCGAGAAGACCCCGGTAAAATCAACTGTTACCTCTGCCCGGGTCAAGCAGATCGTGGTAGA
TGGCTGTGATTTGCTCATCCCGTTGGAGCTTTTGGGCTGGATGCCCACCGGGGACGTGGTGGTTGGATCGACCAT
GGTTTTGAGTACACTGCTGACGGCTCAAGAGGTTTGGGCCCGAGTGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail