Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g9063.t1
Gene name
Locationscaffold_41:46818..49330
Strand+
Gene length (bp)2512
Transcript length (bp)2220
Coding sequence length (bp)2220
Protein length (aa) 740

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03169 OPT OPT oligopeptide transporter protein 4.9E-168 56 696

GO

GO Term Description Terminal node
GO:0055085 transmembrane transport Yes
GO:0008150 biological_process No
GO:0051234 establishment of localization No
GO:0006810 transport No
GO:0051179 localization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

Domain # Start End Length
1 58 80 22
2 90 112 22
3 124 146 22
4 161 183 22
5 220 254 34
6 292 314 22
7 366 388 22
8 417 439 22
9 444 466 22
10 486 508 22
11 529 551 22
12 597 619 22
13 632 654 22
14 684 706 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g9063.t1
MERAQKSQKSPSEQDRIDVLHDRDAEKILPYEADDSPFPEVRAVIQPVNDLTLPVNTVRMWTIGILFTIVGSGLN
QFFSLRQPSVNISALVAQLLAFPLGCAWAKWIPLGVLNPDRHFNIKEHALITIMANVSIGSAAATQIIEALVKFY
NMPSQGGFEVLLCITTQLFGFGLAGMASRWLVGPASMIWPQVLSNAALLTTLHSRSDTIADGWQITRLRFFLYVF
VGGAIWYFVPGYLFTGLSTFAFICWIVPFNVVVNQLFGQTTGLGMSVLTFDWAQVVYANQSPLLVPFWAGLNVMG
SFALFFWLVCPLVYYTNTWYSAHLPLLNSNTFDNTGTPYNTSRIMGSSGRIDQTAYRNYSPMFLPAGYAITFGVA
FANLTGIFFHIALYHGKDLWQQWKGTSKQDVHIRLMSSYRAVPWWWFAAVTVLMFVLSIVTNEVWHTGLPAWGVL
VAFVLPVVYFIPVGVIKALTNISSNQLNLLTEFIGGYAFLGQPVANMAFKFYGYVAVQQGLEFVADMKLAHYMHI
APRLLFVAQGLATLIGAIVQCGVTVFMITRIDGVCTPEAQGNFICPHGKVTYSSSLIWGAVGPGRLFSSGQIYSN
LLWFFLVGPAVVVITYLLGRRWKAANHVSWPVAFGAMSLVPPATGISFSSWWIVNLIFNGVLRHRKPAWWSKYNY
VLSAALDCGVAVATVIIFFCITLPAGSLNWWGNAVSKTTADGKGTPYMGLPAHGYFGPPKGTWE*
Coding >Pro_DTO377G3_2|g9063.t1
ATGGAGAGGGCCCAGAAGAGCCAGAAATCCCCTTCAGAGCAAGATAGAATTGACGTTCTTCACGATCGGGATGCC
GAAAAGATCTTACCCTATGAAGCCGATGATTCGCCTTTTCCCGAGGTGCGGGCTGTCATCCAGCCAGTCAATGAC
TTGACGCTGCCTGTTAACACGGTCCGCATGTGGACTATTGGTATTTTGTTTACTATCGTCGGTAGTGGACTGAAC
CAGTTCTTCAGCTTACGACAGCCCAGTGTGAATATCAGTGCTCTAGTAGCACAGTTACTCGCTTTCCCTCTGGGA
TGCGCCTGGGCGAAATGGATTCCCCTTGGGGTCTTGAATCCCGACCGGCATTTCAATATCAAGGAGCATGCCTTG
ATCACAATCATGGCAAACGTCTCTATTGGCTCTGCTGCTGCCACCCAAATTATCGAAGCGCTTGTCAAGTTCTAT
AATATGCCGTCACAGGGTGGGTTTGAAGTCTTGTTGTGCATTACCACGCAATTGTTTGGCTTCGGCTTAGCCGGC
ATGGCGTCGCGCTGGCTAGTTGGCCCAGCATCGATGATTTGGCCGCAGGTGTTGTCAAATGCCGCACTTTTGACC
ACTCTCCATTCTCGCTCTGATACCATCGCAGATGGCTGGCAGATCACACGTCTTCGCTTCTTTCTTTATGTGTTC
GTCGGTGGTGCCATCTGGTACTTCGTCCCGGGATATCTCTTTACGGGTCTCAGCACATTCGCCTTCATTTGCTGG
ATTGTGCCATTCAATGTGGTGGTGAATCAGCTCTTTGGGCAAACCACCGGACTAGGGATGTCGGTATTGACCTTT
GACTGGGCCCAGGTGGTCTATGCCAACCAAAGCCCCCTGCTTGTTCCCTTCTGGGCTGGCCTTAATGTGATGGGA
TCATTTGCACTCTTCTTTTGGCTTGTGTGCCCCCTCGTTTACTACACCAACACCTGGTATTCCGCACACTTGCCA
CTGCTCAATTCCAACACCTTCGATAATACTGGAACTCCTTATAACACCAGTCGTATCATGGGTTCGAGCGGGAGG
ATCGACCAAACTGCGTATCGGAACTATTCGCCCATGTTTTTACCGGCTGGCTATGCAATCACATTTGGGGTTGCC
TTTGCTAACTTGACGGGCATCTTCTTCCACATCGCGTTGTATCATGGGAAAGACTTGTGGCAACAATGGAAGGGC
ACTAGCAAACAAGACGTCCATATTCGACTGATGTCTTCATATCGAGCCGTACCCTGGTGGTGGTTTGCTGCAGTA
ACTGTCCTGATGTTTGTCTTGAGTATCGTGACCAACGAGGTGTGGCATACGGGTCTACCGGCATGGGGTGTGCTT
GTGGCATTCGTGTTACCAGTGGTCTACTTTATCCCTGTGGGAGTCATCAAAGCGCTCACAAATATCAGTAGTAAC
CAACTGAACCTGCTCACGGAATTCATTGGCGGGTATGCATTCCTCGGGCAGCCCGTGGCCAACATGGCTTTCAAA
TTCTATGGTTATGTCGCCGTCCAGCAAGGACTCGAATTTGTCGCCGATATGAAGTTGGCTCATTATATGCACATC
GCCCCACGCCTTCTGTTTGTAGCCCAAGGCCTTGCCACACTCATCGGAGCTATCGTTCAATGTGGTGTGACAGTG
TTCATGATCACAAGAATTGATGGTGTATGCACCCCTGAAGCCCAGGGAAATTTCATCTGCCCTCATGGAAAGGTC
ACATATTCTTCGTCTCTTATTTGGGGTGCTGTTGGTCCAGGTCGGTTGTTTTCTTCCGGGCAGATATATAGCAAT
CTGCTTTGGTTTTTCCTGGTCGGGCCTGCGGTGGTAGTCATCACCTATCTTCTAGGTCGTCGTTGGAAAGCTGCC
AACCATGTCTCCTGGCCCGTCGCTTTTGGTGCAATGAGTCTAGTCCCACCTGCCACAGGTATCAGCTTCTCCTCG
TGGTGGATAGTCAACTTGATATTCAATGGCGTACTCCGTCACCGCAAACCCGCGTGGTGGTCGAAATACAATTAT
GTACTATCCGCCGCGCTAGACTGCGGCGTTGCAGTCGCTACAGTAATCATTTTCTTTTGCATAACTCTCCCAGCT
GGTTCGTTGAACTGGTGGGGAAATGCTGTGTCGAAAACCACAGCCGACGGCAAAGGCACGCCCTACATGGGCTTA
CCCGCGCATGGCTACTTTGGCCCCCCAAAAGGAACTTGGGAGTGA
Transcript >Pro_DTO377G3_2|g9063.t1
ATGGAGAGGGCCCAGAAGAGCCAGAAATCCCCTTCAGAGCAAGATAGAATTGACGTTCTTCACGATCGGGATGCC
GAAAAGATCTTACCCTATGAAGCCGATGATTCGCCTTTTCCCGAGGTGCGGGCTGTCATCCAGCCAGTCAATGAC
TTGACGCTGCCTGTTAACACGGTCCGCATGTGGACTATTGGTATTTTGTTTACTATCGTCGGTAGTGGACTGAAC
CAGTTCTTCAGCTTACGACAGCCCAGTGTGAATATCAGTGCTCTAGTAGCACAGTTACTCGCTTTCCCTCTGGGA
TGCGCCTGGGCGAAATGGATTCCCCTTGGGGTCTTGAATCCCGACCGGCATTTCAATATCAAGGAGCATGCCTTG
ATCACAATCATGGCAAACGTCTCTATTGGCTCTGCTGCTGCCACCCAAATTATCGAAGCGCTTGTCAAGTTCTAT
AATATGCCGTCACAGGGTGGGTTTGAAGTCTTGTTGTGCATTACCACGCAATTGTTTGGCTTCGGCTTAGCCGGC
ATGGCGTCGCGCTGGCTAGTTGGCCCAGCATCGATGATTTGGCCGCAGGTGTTGTCAAATGCCGCACTTTTGACC
ACTCTCCATTCTCGCTCTGATACCATCGCAGATGGCTGGCAGATCACACGTCTTCGCTTCTTTCTTTATGTGTTC
GTCGGTGGTGCCATCTGGTACTTCGTCCCGGGATATCTCTTTACGGGTCTCAGCACATTCGCCTTCATTTGCTGG
ATTGTGCCATTCAATGTGGTGGTGAATCAGCTCTTTGGGCAAACCACCGGACTAGGGATGTCGGTATTGACCTTT
GACTGGGCCCAGGTGGTCTATGCCAACCAAAGCCCCCTGCTTGTTCCCTTCTGGGCTGGCCTTAATGTGATGGGA
TCATTTGCACTCTTCTTTTGGCTTGTGTGCCCCCTCGTTTACTACACCAACACCTGGTATTCCGCACACTTGCCA
CTGCTCAATTCCAACACCTTCGATAATACTGGAACTCCTTATAACACCAGTCGTATCATGGGTTCGAGCGGGAGG
ATCGACCAAACTGCGTATCGGAACTATTCGCCCATGTTTTTACCGGCTGGCTATGCAATCACATTTGGGGTTGCC
TTTGCTAACTTGACGGGCATCTTCTTCCACATCGCGTTGTATCATGGGAAAGACTTGTGGCAACAATGGAAGGGC
ACTAGCAAACAAGACGTCCATATTCGACTGATGTCTTCATATCGAGCCGTACCCTGGTGGTGGTTTGCTGCAGTA
ACTGTCCTGATGTTTGTCTTGAGTATCGTGACCAACGAGGTGTGGCATACGGGTCTACCGGCATGGGGTGTGCTT
GTGGCATTCGTGTTACCAGTGGTCTACTTTATCCCTGTGGGAGTCATCAAAGCGCTCACAAATATCAGTAGTAAC
CAACTGAACCTGCTCACGGAATTCATTGGCGGGTATGCATTCCTCGGGCAGCCCGTGGCCAACATGGCTTTCAAA
TTCTATGGTTATGTCGCCGTCCAGCAAGGACTCGAATTTGTCGCCGATATGAAGTTGGCTCATTATATGCACATC
GCCCCACGCCTTCTGTTTGTAGCCCAAGGCCTTGCCACACTCATCGGAGCTATCGTTCAATGTGGTGTGACAGTG
TTCATGATCACAAGAATTGATGGTGTATGCACCCCTGAAGCCCAGGGAAATTTCATCTGCCCTCATGGAAAGGTC
ACATATTCTTCGTCTCTTATTTGGGGTGCTGTTGGTCCAGGTCGGTTGTTTTCTTCCGGGCAGATATATAGCAAT
CTGCTTTGGTTTTTCCTGGTCGGGCCTGCGGTGGTAGTCATCACCTATCTTCTAGGTCGTCGTTGGAAAGCTGCC
AACCATGTCTCCTGGCCCGTCGCTTTTGGTGCAATGAGTCTAGTCCCACCTGCCACAGGTATCAGCTTCTCCTCG
TGGTGGATAGTCAACTTGATATTCAATGGCGTACTCCGTCACCGCAAACCCGCGTGGTGGTCGAAATACAATTAT
GTACTATCCGCCGCGCTAGACTGCGGCGTTGCAGTCGCTACAGTAATCATTTTCTTTTGCATAACTCTCCCAGCT
GGTTCGTTGAACTGGTGGGGAAATGCTGTGTCGAAAACCACAGCCGACGGCAAAGGCACGCCCTACATGGGCTTA
CCCGCGCATGGCTACTTTGGCCCCCCAAAAGGAACTTGGGAGTGA
Gene >Pro_DTO377G3_2|g9063.t1
ATGGAGAGGGCCCAGAAGAGCCAGGTGAGTGTCCACTTCTAAGCTGATCCAGATATATCATATCCCCCATATATA
TTGTTATTAACTGTTTCACATCTCAGAAATCCCCTTCAGAGCAAGATAGAATTGACGTTCTTCACGATCGGGATG
CCGAAAAGATCTTACCCTATGAAGCCGATGATTCGCCTTTTCCCGAGGTGCGGGCTGTCATCCAGCCAGTCAATG
ACTTGACGCTGCCTGTTAACACGGTCCGCATGTGGACTATTGGTATTTTGTTTACTATCGTGAGTCTTGTTTTCT
ATGCGACCGGACAATTGGCAAGATAACTAACGTCGACACAGGTCGGTAGTGGACTGAACCAGTTCTTCAGCTTAC
GACAGCCCAGTGTGAATATCAGTGCTCTAGTAGCACAGTTACTCGCTTTCCCTCTGGGATGCGCCTGGGCGAAAT
GGATTCCCCTTGGGGTCTTGAATCCCGACCGGCATTTCAATATCAAGGAGCATGCCTTGATCACAATCATGGCAA
ACGTCTCTATTGGCTCTGCTGCTGCCACCCAAATTATCGAAGCGCTTGTCAAGTTCTATAATATGCCGTCACAGG
GTGGGTTTGAAGTCTTGTTGTGCATTACCACGCAATTGTTTGGCTTCGGCTTAGCCGGCATGGCGTCGCGCTGGC
TAGTTGGCCCAGCATCGATGATTTGGCCGCAGGTGTTGTCAAATGCCGCACTTTTGACCACTCTCCATTCTCGCT
CTGATACCATCGCAGATGGCTGGCAGATCACACGTCTTCGCTTCTTTCTTTATGTGTTCGTCGGTGGTGCCATCT
GGTACTTCGTCCCGGGATATCTCTTTACGGGTCTCAGCACATTCGCCTTCATTTGCTGGATTGTGCCATTCAATG
TGGTGGTGAATCAGCTCTTTGGGCAAACCACCGGACTAGGGATGTCGGTATTGACCTTTGACTGGGCCCAGGTGG
TCTATGCCAACCAAAGCCCCCTGCTTGTTCCCTTCTGGGCTGGCCTTAATGTGATGGGATCATTTGCACTCTTCT
TTTGGCTTGTGTGCCCCCTCGTTTACTACACCAACACCTGGTATTCCGCACACTTGCCACTGCTCAATTCCAACA
CCTTCGATAATACTGGAACTCCTTATAACACCAGTCGTATCATGGGTTCGAGCGGGAGGATCGACCAAACTGCGT
ATCGGAACTATTCGCCCATGTTTTTACCGGCTGGCTATGCAATCACATTTGGGGTTGCCTTTGCTAACTTGACGG
GCATCTTCTTCCACATCGCGTTGTATCATGGGAAAGACTTGTGGCAACAATGGAAGGGCACTAGCAAACAAGACG
TCCATATTCGACTGATGTCTTCATATCGAGCCGTACCCTGGTGGTGGTTTGCTGCAGTAACTGTCCTGATGTTTG
TCTTGAGTATCGTGACCAACGAGGTGTGGCATACGGGTCTACCGGCATGGGGTGTGCTTGTGGCATTCGTGTTAC
CAGTGGTCTACTTTATCCCTGTGGGAGTCATCAAAGCGCTCACAAATATCAGTAGTAACCAACTGAACCTGCTCA
CGGAATTCATTGGCGGGTATGCATTCCTCGGGCAGCCCGTGGCCAACATGGCTTTCAAATTCTATGGTTATGTCG
CCGTCCAGCAAGGACTCGAGTGGGTTACATACCTCCAAAACGGAATTGGCATTGATTAACATCATATTAGATTTG
TCGCCGATATGAAGTTGGCTCATTATATGCACATCGCCCCACGCCTTCTGTTTGTAGCCCAAGGCCTTGCCACAC
TCATCGGAGCTATCGTTCAATGTGGTGTGACAGTGTTCATGATCACAAGAATTGATGGTGTATGCACCCCTGAAG
CCCAGGGAAATTTCATCTGCCCTCATGGAAAGGTCACATATTCTTCGTCTCTTATTTGGGGTGAGTTCCATCTTA
TTGTCGATGTTCTACCATGTCATACCTAATCAACCTTCAGGTGCTGTTGGTCCAGGTCGGTTGTTTTCTTCCGGG
CAGATATATAGCAATCTGCTTTGGTTTTTCCTGGTCGGGCCTGCGGTGGTAGTCATCACCTATCTTCTAGGTCGT
CGTTGGAAAGCTGCCAACCATGTCTCCTGGCCCGTCGCTTTTGGTGCAATGAGTCTAGTCCCACCTGCCACAGGT
ATCAGCTTCTCCTCGTGGTGGATAGTCAACTTGATATTCAATGGCGTACTCCGTCACCGCAAACCCGCGTGGTGG
TCGAAATACAGTATGTTCATGGTTTCCCTTTCATCGTTGATTCTTTTGCTAATCGTCCGCAGATTATGTACTATC
CGCCGCGCTAGACTGCGGCGTTGCAGTCGCTACAGTAATCATTTTCTTTTGCATAACTCTCCCAGCTGGTTCGTT
GAACTGGTGGGGAAATGCTGTGTCGAAAACCACAGCCGACGGCAAAGGCACGCCCTACATGGGCTTACCCGCGCA
TGGCTACTTTGGCCCCCCAAAAGGAACTTGGGAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail