Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g9061.t1
Gene name
Locationscaffold_41:41187..44653
Strand-
Gene length (bp)3466
Transcript length (bp)2232
Coding sequence length (bp)2232
Protein length (aa) 744

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase 4.2E-26 416 533
PF00072 Response_reg Response regulator receiver domain 6.9E-18 570 659
PF00512 HisKA His Kinase A (phospho-acceptor) domain 1.6E-16 306 370
PF13426 PAS_9 PAS domain 2.0E-10 185 287
PF08448 PAS_4 PAS fold 2.5E-05 53 143
PF00989 PAS PAS fold 4.5E-08 186 284

GO

GO Term Description Terminal node
GO:0000160 phosphorelay signal transduction system Yes
GO:0000155 phosphorelay sensor kinase activity Yes
GO:0007165 signal transduction Yes
GO:0006355 regulation of transcription, DNA-templated Yes
GO:0016773 phosphotransferase activity, alcohol group as acceptor No
GO:0065007 biological regulation No
GO:1903506 regulation of nucleic acid-templated transcription No
GO:0140096 catalytic activity, acting on a protein No
GO:0004672 protein kinase activity No
GO:2000112 regulation of cellular macromolecule biosynthetic process No
GO:0035556 intracellular signal transduction No
GO:0016740 transferase activity No
GO:0050794 regulation of cellular process No
GO:0050789 regulation of biological process No
GO:0080090 regulation of primary metabolic process No
GO:0016775 phosphotransferase activity, nitrogenous group as acceptor No
GO:0019219 regulation of nucleobase-containing compound metabolic process No
GO:0016301 kinase activity No
GO:0060255 regulation of macromolecule metabolic process No
GO:0010556 regulation of macromolecule biosynthetic process No
GO:0010468 regulation of gene expression No
GO:0019222 regulation of metabolic process No
GO:0140299 small molecule sensor activity No
GO:2001141 regulation of RNA biosynthetic process No
GO:0003674 molecular_function No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0008150 biological_process No
GO:0003824 catalytic activity No
GO:0051171 regulation of nitrogen compound metabolic process No
GO:0031323 regulation of cellular metabolic process No
GO:0031326 regulation of cellular biosynthetic process No
GO:0004673 protein histidine kinase activity No
GO:0009987 cellular process No
GO:0051252 regulation of RNA metabolic process No
GO:0009889 regulation of biosynthetic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 29 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g9061.t1
MPVDQMLHLRIDCPMNNVAMVITPPAESDLNLENKSLEQPVVGSLSRIYRFTPKPTLVLDGALRIVEVSNSHVEV
FKHSRDQLLAANVYDLPPSILPAPDIASLIGALGTAISTREVQVIQRVHVAKVDAFFSLSVTPIFEDDSLIYMLL
EAQRIKHHRHRSNSISDDAYPNEIYKILVDTVRDYAIFMLDTRGHIATWNSGAAILKGYTSSEIIGQHFSIFYGR
DDREIKKPVRELEVCLQEGKLEDEGWRYHKDGNRFWANVMITAIYQNGSHVGFVKVTRDMTERRATEARLIDAFE
ESAKLKSDFLANMSHELRTPMNGMLLALTMLMRTELTDDQREFGSILEDSTSILLQVINDVLDYSKLSSGTFPLN
TDVVHIPDVISAVVRNCQSALKPGVKIMGDVSAGFPPNLKGDPLRFRQVLQNMVTNAVKFTESGHVRVHATYTID
EKDPDMYVISTQVVDTGIGVPEDASNTLFTPFTRFADTATKRYQGTGLGLSICKSLAELMGGAVGFHANPDGRGS
VFWMTAKMARLTSPVSTVKQRLQPAIPEALDNSASLEKIAPHKHILLVEDNKVNQLIMLKLLSSLGFKRVDAAWD
GAEAVRMVKQKPLAYNVILMDISMPVMDGLTATEHIRRMKLDMPILALTGNALKGDAETLVRLIMYWLRVNLSGV
VFFPRIMFGELAEERNPSYGPRVTRLNFPRGVDLVWSRYEWISSILALFGCRGLSIVGQLAVLPLGWV*
Coding >Pro_DTO377G3_2|g9061.t1
ATGCCTGTGGATCAGATGCTCCACCTGAGAATCGACTGTCCTATGAACAATGTCGCGATGGTGATCACGCCTCCG
GCCGAGAGTGACTTGAATCTGGAGAACAAATCCCTTGAACAGCCCGTTGTCGGATCGTTGAGTCGCATCTATCGA
TTTACACCGAAACCGACTCTCGTTTTAGACGGCGCTCTGCGAATCGTCGAAGTGTCCAACAGTCATGTGGAAGTC
TTCAAGCACTCACGAGACCAACTGTTGGCAGCGAATGTCTACGATCTTCCCCCCTCCATCCTCCCAGCCCCCGAT
ATCGCCTCCCTGATCGGGGCTCTTGGCACTGCCATATCAACTCGCGAAGTGCAGGTCATCCAGCGTGTTCACGTG
GCAAAAGTCGACGCTTTCTTCTCACTTAGCGTGACACCCATCTTTGAAGATGACTCGCTGATCTACATGCTACTG
GAAGCCCAGCGGATCAAACATCACCGGCATCGGTCGAATTCCATCAGCGACGATGCCTATCCCAACGAAATTTAC
AAAATCTTGGTCGACACCGTGAGGGATTATGCCATTTTCATGCTCGATACGCGCGGCCATATTGCGACATGGAAT
TCGGGCGCCGCTATTCTGAAGGGATACACATCCTCCGAGATCATCGGCCAGCATTTCTCCATCTTTTACGGTCGC
GATGACCGCGAAATAAAAAAACCCGTCCGCGAGCTGGAGGTCTGTTTACAAGAAGGAAAACTGGAGGATGAGGGC
TGGCGTTATCACAAGGATGGCAACCGGTTTTGGGCCAATGTCATGATCACTGCCATCTATCAGAACGGCAGCCAT
GTGGGATTCGTGAAAGTTACCCGCGACATGACTGAACGCCGGGCGACAGAGGCGCGTTTGATTGACGCCTTTGAA
GAATCGGCCAAGCTCAAGTCCGATTTCTTGGCCAACATGTCCCACGAATTGCGCACCCCGATGAATGGCATGCTC
TTGGCTTTGACAATGCTAATGAGGACCGAATTGACTGATGACCAGCGGGAATTCGGATCCATCCTGGAAGACTCA
ACATCTATCTTGCTGCAGGTCATTAACGATGTCCTAGATTATTCCAAGCTATCGTCGGGAACCTTCCCCTTGAAC
ACAGACGTTGTCCACATCCCCGACGTGATCTCGGCTGTCGTTCGGAATTGTCAGTCGGCGCTGAAGCCCGGTGTC
AAAATCATGGGCGATGTAAGCGCGGGCTTTCCTCCAAACCTCAAAGGTGACCCGCTGCGATTCCGCCAAGTTCTG
CAAAATATGGTCACCAACGCAGTGAAATTCACCGAGAGTGGTCATGTTCGAGTTCATGCCACCTATACCATCGAT
GAAAAGGACCCCGATATGTATGTAATCTCCACGCAGGTAGTGGACACTGGTATCGGCGTACCCGAAGATGCCTCA
AACACCCTCTTCACCCCCTTCACGCGATTCGCGGACACGGCCACAAAAAGGTACCAGGGTACGGGCCTTGGCCTG
TCGATATGCAAGAGCCTGGCTGAATTGATGGGTGGAGCGGTTGGTTTCCATGCCAATCCCGACGGACGCGGTAGT
GTGTTCTGGATGACAGCCAAAATGGCTCGCCTTACCTCGCCAGTGTCTACAGTGAAGCAGAGATTGCAACCGGCT
ATACCTGAGGCATTGGATAATTCCGCCTCGCTCGAGAAGATCGCCCCACACAAACACATCCTCCTTGTCGAAGAC
AACAAGGTCAATCAACTTATTATGTTAAAACTTCTCAGCAGCCTGGGTTTCAAGCGCGTCGATGCTGCCTGGGAT
GGAGCGGAAGCAGTGCGTATGGTGAAGCAGAAGCCTTTGGCCTATAATGTCATCCTGATGGACATCAGCATGCCG
GTCATGGATGGATTAACCGCCACAGAGCACATTCGACGGATGAAACTCGATATGCCCATCCTTGCGTTGACGGGC
AATGCTCTCAAGGGAGACGCAGAGACCCTTGTGCGTTTGATCATGTACTGGTTGCGAGTCAATCTCTCAGGGGTA
GTTTTTTTCCCGAGGATCATGTTCGGAGAACTTGCCGAAGAACGCAACCCTTCATATGGACCCCGTGTGACCCGC
CTTAACTTTCCGAGGGGTGTTGATTTGGTATGGTCACGTTATGAATGGATAAGCTCTATCCTTGCCCTGTTTGGT
TGCCGGGGTCTTAGCATCGTTGGTCAACTGGCTGTCCTTCCTCTTGGGTGGGTTTAG
Transcript >Pro_DTO377G3_2|g9061.t1
ATGCCTGTGGATCAGATGCTCCACCTGAGAATCGACTGTCCTATGAACAATGTCGCGATGGTGATCACGCCTCCG
GCCGAGAGTGACTTGAATCTGGAGAACAAATCCCTTGAACAGCCCGTTGTCGGATCGTTGAGTCGCATCTATCGA
TTTACACCGAAACCGACTCTCGTTTTAGACGGCGCTCTGCGAATCGTCGAAGTGTCCAACAGTCATGTGGAAGTC
TTCAAGCACTCACGAGACCAACTGTTGGCAGCGAATGTCTACGATCTTCCCCCCTCCATCCTCCCAGCCCCCGAT
ATCGCCTCCCTGATCGGGGCTCTTGGCACTGCCATATCAACTCGCGAAGTGCAGGTCATCCAGCGTGTTCACGTG
GCAAAAGTCGACGCTTTCTTCTCACTTAGCGTGACACCCATCTTTGAAGATGACTCGCTGATCTACATGCTACTG
GAAGCCCAGCGGATCAAACATCACCGGCATCGGTCGAATTCCATCAGCGACGATGCCTATCCCAACGAAATTTAC
AAAATCTTGGTCGACACCGTGAGGGATTATGCCATTTTCATGCTCGATACGCGCGGCCATATTGCGACATGGAAT
TCGGGCGCCGCTATTCTGAAGGGATACACATCCTCCGAGATCATCGGCCAGCATTTCTCCATCTTTTACGGTCGC
GATGACCGCGAAATAAAAAAACCCGTCCGCGAGCTGGAGGTCTGTTTACAAGAAGGAAAACTGGAGGATGAGGGC
TGGCGTTATCACAAGGATGGCAACCGGTTTTGGGCCAATGTCATGATCACTGCCATCTATCAGAACGGCAGCCAT
GTGGGATTCGTGAAAGTTACCCGCGACATGACTGAACGCCGGGCGACAGAGGCGCGTTTGATTGACGCCTTTGAA
GAATCGGCCAAGCTCAAGTCCGATTTCTTGGCCAACATGTCCCACGAATTGCGCACCCCGATGAATGGCATGCTC
TTGGCTTTGACAATGCTAATGAGGACCGAATTGACTGATGACCAGCGGGAATTCGGATCCATCCTGGAAGACTCA
ACATCTATCTTGCTGCAGGTCATTAACGATGTCCTAGATTATTCCAAGCTATCGTCGGGAACCTTCCCCTTGAAC
ACAGACGTTGTCCACATCCCCGACGTGATCTCGGCTGTCGTTCGGAATTGTCAGTCGGCGCTGAAGCCCGGTGTC
AAAATCATGGGCGATGTAAGCGCGGGCTTTCCTCCAAACCTCAAAGGTGACCCGCTGCGATTCCGCCAAGTTCTG
CAAAATATGGTCACCAACGCAGTGAAATTCACCGAGAGTGGTCATGTTCGAGTTCATGCCACCTATACCATCGAT
GAAAAGGACCCCGATATGTATGTAATCTCCACGCAGGTAGTGGACACTGGTATCGGCGTACCCGAAGATGCCTCA
AACACCCTCTTCACCCCCTTCACGCGATTCGCGGACACGGCCACAAAAAGGTACCAGGGTACGGGCCTTGGCCTG
TCGATATGCAAGAGCCTGGCTGAATTGATGGGTGGAGCGGTTGGTTTCCATGCCAATCCCGACGGACGCGGTAGT
GTGTTCTGGATGACAGCCAAAATGGCTCGCCTTACCTCGCCAGTGTCTACAGTGAAGCAGAGATTGCAACCGGCT
ATACCTGAGGCATTGGATAATTCCGCCTCGCTCGAGAAGATCGCCCCACACAAACACATCCTCCTTGTCGAAGAC
AACAAGGTCAATCAACTTATTATGTTAAAACTTCTCAGCAGCCTGGGTTTCAAGCGCGTCGATGCTGCCTGGGAT
GGAGCGGAAGCAGTGCGTATGGTGAAGCAGAAGCCTTTGGCCTATAATGTCATCCTGATGGACATCAGCATGCCG
GTCATGGATGGATTAACCGCCACAGAGCACATTCGACGGATGAAACTCGATATGCCCATCCTTGCGTTGACGGGC
AATGCTCTCAAGGGAGACGCAGAGACCCTTGTGCGTTTGATCATGTACTGGTTGCGAGTCAATCTCTCAGGGGTA
GTTTTTTTCCCGAGGATCATGTTCGGAGAACTTGCCGAAGAACGCAACCCTTCATATGGACCCCGTGTGACCCGC
CTTAACTTTCCGAGGGGTGTTGATTTGGTATGGTCACGTTATGAATGGATAAGCTCTATCCTTGCCCTGTTTGGT
TGCCGGGGTCTTAGCATCGTTGGTCAACTGGCTGTCCTTCCTCTTGGGTGGGTTTAG
Gene >Pro_DTO377G3_2|g9061.t1
ATGCCTGTGGATCAGATGCTCCACCTGAGAATCGACTGTCCTATGAACAATGTCGCGATGGTGATCACGCCTCCG
GCCGAGAGTGACTTGAATCTGGAGAACAAATCCCTTGAACAGCCCGTTGTCGGATCGTTGAGTCGCATCTATCGA
TTTACACCGTGAGAACCCGAACCCCTTGGAGGGATAGCATGGATTATTCCCGTTAACCCCTGTAGGAAACCGACT
CTCGTTTTAGACGGCGCTCTGCGAATCGTCGAAGTGTCCAACAGTCATGTGGAAGTCTTCAAGCACTCACGAGAC
CAACTGTTGGCAGCGAATGTCTACGATCTTCCCCCCTCCATCCTCCCAGCCCCCGATATCGCCTCCCTGATCGGG
GCTCTTGGCACTGCCATATCAACTCGCGAAGTGCAGGTCATCCAGCGTGTTCACGTGGCAAAAGTCGACGCTTTC
TTCTCACTTAGCGTGACACCCATCTTTGAAGATGACTCGCTGATCTACATGCTACTGGAAGCCCAGCGGATCAAA
CATCACCGGCATCGGTCGAATTCCATCAGCGACGATGCCTATCCCAACGAAATTTACAAAATCTTGGTCGACACC
GTGAGGGATTATGCCATTTTCATGCTCGATACGCGCGGCCATATTGCGACATGGAATTCGGGCGCCGCTATTCTG
AAGGGATACACATCCTCCGAGATCATCGGCCAGCATTTCTCCATCTTTTACGGTCGCGATGACCGCGAAATAAAA
AAACCCGTCCGCGAGCTGGAGGTCTGTTTACAAGAAGGAAAACTGGAGGATGAGGGCTGGCGTTATCACAAGGAT
GGCAACCGGTTTTGGGCCAATGTCATGATCACTGCCATCTATCAGAACGGCAGCCATGTGGGATTCGTGAAAGTT
ACCCGCGACATGACTGAACGCCGGGCGACAGAGGCGCGTTTGATTGACGCCTTTGAAGAATCGGCCAAGCTCAAG
TCCGATTTCTTGGCCAACATGTCCCACGAATTGCGCACCCCGATGAATGGCATGCTCTTGGCTTTGACAATGCTA
ATGAGGACCGAATTGACTGATGACCAGCGGGAATTCGGATCCATCCTGGAAGACTCAACATCTATCTTGCTGCAG
GTCATTAACGATGTCCTAGATTATTCCAAGCTATCGTCGGGAACCTTCCCCTTGAACACAGACGTTGTCCACATC
CCCGACGTGATCTCGGCTGTCGTTCGGAATTGTCAGTCGGCGCTGAAGCCCGGTGTCAAAATCATGGGCGATGTA
AGCGCGGGCTTTCCTCCAAACCTCAAAGGTGACCCGCTGCGATTCCGCCAAGTTCTGCAAAATATGGTCACCAAC
GCAGTGAAATTCACCGAGAGTGGTCATGTTCGAGTTCATGCCACCTATACCATCGATGAAAAGGACCCCGATATG
TATGTAATCTCCACGCAGGTAGTGGACACTGGTATCGGCGTACCCGAAGATGCCTCAAACACCCTCTTCACCCCC
TTCACGCGATTCGCGGACACGGCCACAAAAAGGTACCAGGGTACGGGCCTTGGCCTGTCGATATGCAAGAGCCTG
GCTGAATTGATGGGTGGAGCGGTTGGTTTCCATGCCAATCCCGACGGACGCGGTAGTGTGTTCTGGATGACAGCC
AAAATGGCTCGCCTTACCTCGCCAGTGTCTACAGTGAAGCAGAGATTGCAACCGGCTATACCTGAGGCATTGGAT
AATTCCGCCTCGCTCGAGAAGATCGCCCCACACAAACACATCCTCCTTGTCGAAGACAACAAGGTCAATCAACTT
ATTATGTTAAAACTTCTCAGCAGCCTGGGTTTCAAGCGCGTCGATGCTGCCTGGGATGGAGCGGAAGCAGTGCGT
ATGGTGAAGCAGAAGCCTTTGGCCTATAATGTCATCCTGATGGACATCAGCATGCCGGTCATGGATGGATTAACC
GCCACAGAGCACATTCGACGGATGAAACTCGATATGCCCATCCTTGCGTTGACGGGCAATGCTCTCAAGGGAGAC
GCAGAGACGTATTTGGCGAAGGGGATGGACGATTACATCGCCAAGCCCTTGCATCGGCAGCAGCTGGTGGATTTA
TTATGGAAATGGTGTGGATCCTGAATGGTTGGTTATTTCAAATTGAGAAGGGAATTGTGCCCTCGAATATCACGT
CAGTTTGAGGCCGCCTTTTGATGCGCTCAAGGCACGGCAGTTGAAATATACCCGTGTCAGTGTCATGGACGAGAG
ACCTTGCGGTCGAACCGTCAGTTTGAGAATTTTCAACCACATCCCCTTACCGATGTGGCAGAAGTGCCGCCATTT
TCACCTGAACCTTCCAGGCAACAGTCTGCCTATGTCTTTAGTTCTGGGATTTCTGGGAGTTCATTCAAATTTTGA
TCTCCAGTTCTCCGCTAATAACCTGCACCCGAACATCGACGGCAATGCCATCCGCCGACATAAAGTTCTCTGCAC
ATGAGATACCCCAAGGGCTTCCATCCTTTGCTCGCATGACTTCTGCCTGGAAAAGGCACATGCAACCGTGTTTCT
GCCACCGACGTTGCAATTATGCAGCCTTGGGTGGTCTTCTGTATCAACTCTTCAATACCACTCATGAGATCATCC
CTATCTGCGGAGTTTAGGCAGCCGTGTAGTGTATGGATGATATTTGCGATGCAAGACTCGCATGGTCCCCCGTAG
TGTCCATGGCGTTGGAATAGCCGCCAATCCTTTAAATCGTAAATTGATGCACAGTGTGTGGAGTGCATAAGACTG
GACTTTTACCATTTGACCACCTGGGCAAGTATCCCCCGATAATCCCACCGAATTGCAAGATGATGCTTTAACATC
AACAGTGGATTCAAGCCTGATCTTGGTCCCGAACCGATTCAAGTTTTTCCCAACATTTCCGAATGTACAGTAGCA
ACGACCTCATTTCGGCACCAAAGAACCGGAAATCTTTTGGTTATGATTCGACATTCGACGTCTAATGGTCCAAGC
CTTGTGCGTTTGATCATGTACTGGTTGCGAGTCAATCTCTCAGGGGTAGTTTTTTTCCCGAGGTACAACACCGGT
GATCCGTTAATTTCGCGTGAGGTCATTGTTCTCATATCGGTAATTGCTAGGATCATGTTCGGAGGTTTGAACCCA
ATGGAACCTCTACGACCGAAGACGAAGATACATGTTTCTAAGTGTCTTGAATCTCGTCCACTTGATGGGTTGTAA
CGACGCGGTTTTTGAGAACTTGCCGAAGAACGCAACCCTTCATATGGACCCCGTGTGACCCGCCTTAACTTTCCG
AGGGGTGTTGATTTGGTATGGTCACGTTATGAATGGCATGTTCAACCCTTAGCGAGATCATTACAGGCTAATGGC
AAACAGGATAAGCTCTATCCTTGCCCTGTTTGGTTGCCGGGGTCTTAGCATCGTTGGTCAACTGGCTGTCCTTCC
TCTTGGGTGGGTTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail