Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g9057.t1
Gene name
Locationscaffold_41:30959..34376
Strand-
Gene length (bp)3417
Transcript length (bp)2319
Coding sequence length (bp)2319
Protein length (aa) 773

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13649 Methyltransf_25 Methyltransferase domain 3.3E-17 69 151
PF13847 Methyltransf_31 Methyltransferase domain 5.0E-13 64 140
PF08241 Methyltransf_11 Methyltransferase domain 1.4E-10 70 150
PF13472 Lipase_GDSL_2 GDSL-like Lipase/Acylhydrolase family 2.6E-08 547 729
PF05175 MTS Methyltransferase small domain 5.5E-06 61 139
PF00856 SET SET domain 9.0E-06 502 548
PF01209 Ubie_methyltran ubiE/COQ5 methyltransferase family 5.8E-06 62 140
PF02390 Methyltransf_4 Putative methyltransferase 9.3E-06 68 124

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0006400 tRNA modification Yes
GO:0008168 methyltransferase activity Yes
GO:0008176 tRNA (guanine-N7-)-methyltransferase activity Yes
GO:1901360 organic cyclic compound metabolic process No
GO:0005488 binding No
GO:0008152 metabolic process No
GO:0006399 tRNA metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0016740 transferase activity No
GO:0071704 organic substance metabolic process No
GO:0009451 RNA modification No
GO:0016741 transferase activity, transferring one-carbon groups No
GO:0008150 biological_process No
GO:0006396 RNA processing No
GO:0006725 cellular aromatic compound metabolic process No
GO:0016423 tRNA (guanine) methyltransferase activity No
GO:0016070 RNA metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0003824 catalytic activity No
GO:0008173 RNA methyltransferase activity No
GO:0008757 S-adenosylmethionine-dependent methyltransferase activity No
GO:0034660 ncRNA metabolic process No
GO:0140640 catalytic activity, acting on a nucleic acid No
GO:0044238 primary metabolic process No
GO:0009987 cellular process No
GO:0044237 cellular metabolic process No
GO:0090304 nucleic acid metabolic process No
GO:0140101 catalytic activity, acting on a tRNA No
GO:0008033 tRNA processing No
GO:0008175 tRNA methyltransferase activity No
GO:0140098 catalytic activity, acting on RNA No
GO:0006807 nitrogen compound metabolic process No
GO:0003674 molecular_function No
GO:0046483 heterocycle metabolic process No
GO:0043412 macromolecule modification No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0034470 ncRNA processing No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g9057.t1
MTIPSLGRVASLFPHIEKDWWKKAYNEMYLYTDGDCVEVPAITEAECNDIIGISSVQQLLKTQESSIKVLDLCCG
QGRHSINLAKRFPSVNFYGIDQSTYLLDLARKRAIEENVQSNVTFQKGDLRRIPASDCSFDLVILLGNSFGHCND
EGDLHQSGWEWLEGKEKLLACRERELSPDKTLLASREIVIDLEGPSIRQDLFYSVRLYDLEEMDNLLQRSGLFLQ
AEDGMQITATKRDGPVDMGMMERRQLIVAQKPVKSTAAKPPAVDALEQDADIYVHPNLTQSYNPHKGRLLQVSAF
VSAGTMILADTPYALIPSADPSHPDASICSNLKCRQQVSRDTHREICQRNCIRDVVWCDNRCRTADQARHDFECA
WLKNYGESLRQNEGQYAFAMLWTVMRLLAGRYIELQAGFKPSELYSWEDRFKRGWDSIEILHSNRERWPQTQILH
WKRLVEVYLTHDNQSDLSVDDLVDLICKEESNSFGLYPSDTGIFPIPDPPIERGVDYGLGIYPRASIVNHSCIPN
VIWRADNNGRMVLTTSKDLAAGDDTTATQSSNGGGWGDGLLNTTLFKGASGRNFGHNGATTVSFRSGGYWDEVLT
TVRQVRDDYHPLVTIQFGHDDQKPAANISLSQYTRNLERFVTEASNAGATPILVTPLSRRNYDKSTGTPRIVMSL
ANETLATIIAAHRSNAAYIDLNKTSTWYLNAIGPENAFTYNLNPADYTHLNVPGSILFGGIVAELITQKLGTLEK
SGYLRVNDKLKKNVDYGIYYWP*
Coding >Pro_DTO377G3_2|g9057.t1
ATGACAATTCCTAGTCTTGGCCGTGTTGCCTCATTGTTTCCTCATATCGAGAAAGATTGGTGGAAGAAGGCCTAC
AATGAGATGTACCTCTACACCGATGGTGACTGTGTCGAAGTCCCCGCAATCACAGAAGCCGAATGCAACGACATC
ATCGGAATATCTAGCGTGCAACAGCTGTTGAAAACCCAAGAATCTTCGATCAAGGTATTGGATCTATGCTGTGGC
CAAGGCCGACATAGCATCAATCTTGCCAAACGCTTTCCATCGGTGAATTTTTACGGCATCGATCAGAGCACATAT
CTCCTTGACCTTGCTCGAAAACGCGCAATAGAAGAAAACGTGCAGAGTAACGTCACGTTTCAGAAGGGAGACCTT
CGTCGGATTCCTGCATCGGATTGTTCCTTTGATCTGGTCATACTTCTGGGAAATTCTTTTGGACACTGTAATGAT
GAAGGAGACCTACATCAAAGTGGATGGGAATGGCTTGAGGGCAAAGAAAAACTTCTGGCCTGCCGGGAACGAGAG
CTGTCTCCCGACAAAACCCTCCTCGCTAGCCGAGAGATTGTGATTGATTTGGAAGGTCCTTCGATCCGCCAAGAT
CTTTTCTATTCCGTCAGACTTTACGATCTGGAGGAAATGGACAACCTTCTCCAAAGATCTGGCCTATTCCTTCAA
GCAGAAGATGGGATGCAGATCACAGCGACCAAGCGAGACGGCCCTGTGGACATGGGTATGATGGAACGCAGGCAG
TTGATCGTTGCACAGAAGCCAGTCAAGTCCACAGCTGCCAAGCCCCCAGCTGTCGATGCTCTGGAGCAAGACGCG
GATATCTACGTGCATCCAAACCTGACACAAAGCTACAATCCTCACAAAGGAAGATTGCTACAAGTCTCGGCATTT
GTGTCAGCCGGTACCATGATTCTGGCAGATACACCATATGCTTTGATCCCGTCTGCGGATCCATCCCATCCTGAT
GCCTCGATTTGCAGTAACCTGAAATGCCGCCAACAAGTGTCACGGGACACACATAGAGAGATTTGCCAAAGGAAT
TGCATCCGGGATGTTGTTTGGTGTGACAATCGTTGTCGGACGGCAGACCAGGCTCGGCATGACTTTGAATGCGCT
TGGTTGAAAAACTACGGAGAAAGTCTTCGTCAAAACGAGGGCCAGTATGCATTTGCCATGCTTTGGACAGTCATG
CGTCTTCTAGCTGGAAGGTACATTGAGTTACAGGCAGGGTTCAAGCCATCTGAGCTCTATTCCTGGGAAGATCGG
TTCAAGCGGGGGTGGGATTCCATTGAGATCCTCCACAGTAACCGGGAGAGGTGGCCTCAGACGCAGATTTTGCAC
TGGAAGAGGCTAGTTGAGGTATATCTAACTCACGATAATCAGTCAGACCTTAGCGTTGATGATCTAGTGGATCTC
ATCTGCAAAGAAGAGTCTAATTCGTTCGGGCTATATCCAAGTGACACTGGGATATTTCCCATTCCGGACCCCCCA
ATCGAACGAGGCGTGGATTATGGCTTGGGTATCTACCCAAGAGCCTCTATAGTCAACCATTCCTGCATTCCAAAT
GTCATCTGGAGAGCAGACAACAATGGGCGGATGGTATTGACTACCTCAAAAGATCTTGCCGCAGGCGACGACACC
ACGGCAACTCAATCCTCGAACGGAGGAGGATGGGGAGATGGACTTCTCAATACAACCCTTTTCAAAGGAGCATCT
GGTCGCAATTTCGGTCACAACGGTGCAACCACTGTTAGCTTCCGGAGCGGAGGTTATTGGGACGAGGTTCTAACA
ACCGTGAGACAAGTTCGAGACGACTATCATCCACTTGTTACAATCCAATTCGGCCACGACGACCAAAAGCCCGCA
GCAAACATTTCATTATCACAATACACCAGGAATCTTGAAAGATTCGTGACTGAGGCCTCTAATGCTGGGGCTACA
CCGATTCTCGTCACTCCTCTATCTCGGCGCAACTACGATAAATCAACAGGGACACCGCGTATCGTCATGAGTCTC
GCCAATGAGACCTTGGCCACCATCATTGCCGCTCATCGCTCAAACGCTGCCTATATTGATCTGAATAAAACTAGC
ACCTGGTATCTCAATGCAATCGGGCCAGAAAATGCTTTTACATACAACCTCAACCCAGCGGATTATACCCATTTG
AACGTGCCGGGGAGCATTTTGTTTGGGGGAATTGTGGCCGAACTTATTACGCAGAAACTTGGGACTCTGGAAAAG
TCTGGATATCTGCGCGTGAATGACAAACTGAAGAAGAATGTTGATTATGGGATCTATTACTGGCCTTGA
Transcript >Pro_DTO377G3_2|g9057.t1
ATGACAATTCCTAGTCTTGGCCGTGTTGCCTCATTGTTTCCTCATATCGAGAAAGATTGGTGGAAGAAGGCCTAC
AATGAGATGTACCTCTACACCGATGGTGACTGTGTCGAAGTCCCCGCAATCACAGAAGCCGAATGCAACGACATC
ATCGGAATATCTAGCGTGCAACAGCTGTTGAAAACCCAAGAATCTTCGATCAAGGTATTGGATCTATGCTGTGGC
CAAGGCCGACATAGCATCAATCTTGCCAAACGCTTTCCATCGGTGAATTTTTACGGCATCGATCAGAGCACATAT
CTCCTTGACCTTGCTCGAAAACGCGCAATAGAAGAAAACGTGCAGAGTAACGTCACGTTTCAGAAGGGAGACCTT
CGTCGGATTCCTGCATCGGATTGTTCCTTTGATCTGGTCATACTTCTGGGAAATTCTTTTGGACACTGTAATGAT
GAAGGAGACCTACATCAAAGTGGATGGGAATGGCTTGAGGGCAAAGAAAAACTTCTGGCCTGCCGGGAACGAGAG
CTGTCTCCCGACAAAACCCTCCTCGCTAGCCGAGAGATTGTGATTGATTTGGAAGGTCCTTCGATCCGCCAAGAT
CTTTTCTATTCCGTCAGACTTTACGATCTGGAGGAAATGGACAACCTTCTCCAAAGATCTGGCCTATTCCTTCAA
GCAGAAGATGGGATGCAGATCACAGCGACCAAGCGAGACGGCCCTGTGGACATGGGTATGATGGAACGCAGGCAG
TTGATCGTTGCACAGAAGCCAGTCAAGTCCACAGCTGCCAAGCCCCCAGCTGTCGATGCTCTGGAGCAAGACGCG
GATATCTACGTGCATCCAAACCTGACACAAAGCTACAATCCTCACAAAGGAAGATTGCTACAAGTCTCGGCATTT
GTGTCAGCCGGTACCATGATTCTGGCAGATACACCATATGCTTTGATCCCGTCTGCGGATCCATCCCATCCTGAT
GCCTCGATTTGCAGTAACCTGAAATGCCGCCAACAAGTGTCACGGGACACACATAGAGAGATTTGCCAAAGGAAT
TGCATCCGGGATGTTGTTTGGTGTGACAATCGTTGTCGGACGGCAGACCAGGCTCGGCATGACTTTGAATGCGCT
TGGTTGAAAAACTACGGAGAAAGTCTTCGTCAAAACGAGGGCCAGTATGCATTTGCCATGCTTTGGACAGTCATG
CGTCTTCTAGCTGGAAGGTACATTGAGTTACAGGCAGGGTTCAAGCCATCTGAGCTCTATTCCTGGGAAGATCGG
TTCAAGCGGGGGTGGGATTCCATTGAGATCCTCCACAGTAACCGGGAGAGGTGGCCTCAGACGCAGATTTTGCAC
TGGAAGAGGCTAGTTGAGGTATATCTAACTCACGATAATCAGTCAGACCTTAGCGTTGATGATCTAGTGGATCTC
ATCTGCAAAGAAGAGTCTAATTCGTTCGGGCTATATCCAAGTGACACTGGGATATTTCCCATTCCGGACCCCCCA
ATCGAACGAGGCGTGGATTATGGCTTGGGTATCTACCCAAGAGCCTCTATAGTCAACCATTCCTGCATTCCAAAT
GTCATCTGGAGAGCAGACAACAATGGGCGGATGGTATTGACTACCTCAAAAGATCTTGCCGCAGGCGACGACACC
ACGGCAACTCAATCCTCGAACGGAGGAGGATGGGGAGATGGACTTCTCAATACAACCCTTTTCAAAGGAGCATCT
GGTCGCAATTTCGGTCACAACGGTGCAACCACTGTTAGCTTCCGGAGCGGAGGTTATTGGGACGAGGTTCTAACA
ACCGTGAGACAAGTTCGAGACGACTATCATCCACTTGTTACAATCCAATTCGGCCACGACGACCAAAAGCCCGCA
GCAAACATTTCATTATCACAATACACCAGGAATCTTGAAAGATTCGTGACTGAGGCCTCTAATGCTGGGGCTACA
CCGATTCTCGTCACTCCTCTATCTCGGCGCAACTACGATAAATCAACAGGGACACCGCGTATCGTCATGAGTCTC
GCCAATGAGACCTTGGCCACCATCATTGCCGCTCATCGCTCAAACGCTGCCTATATTGATCTGAATAAAACTAGC
ACCTGGTATCTCAATGCAATCGGGCCAGAAAATGCTTTTACATACAACCTCAACCCAGCGGATTATACCCATTTG
AACGTGCCGGGGAGCATTTTGTTTGGGGGAATTGTGGCCGAACTTATTACGCAGAAACTTGGGACTCTGGAAAAG
TCTGGATATCTGCGCGTGAATGACAAACTGAAGAAGAATGTTGATTATGGGATCTATTACTGGCCTTGA
Gene >Pro_DTO377G3_2|g9057.t1
ATGACAATTCCTAGTCTTGGCCGTGTTGCCTCATTGTTTCCTCATATCGAGAAAGATTGGTGGAAGAAGGCCTAC
AATGAGATGTACCTCTACACCGATGGTGACTGTGTCGAAGTCCCCGCAATCACAGAAGCCGAATGCAACGACATC
ATCGGAATATCTAGCGTGCAACAGCTGTTGAAAACCCAAGAATCTTCGATCAAGGTATTGGATCTATGCTGTGGC
CAAGGCCGACATAGCATCAATCTTGCCAAACGCTTTCCATCGGTGAATTTTTACGGCATCGATCAGAGCACATAT
CTCCTTGACCTTGCTCGAAAACGCGCAATAGAAGAAAACGTGCAGAGTAACGTCACGTTTCAGAAGGGAGACCTT
CGTCGGATTCCTGCATCGGATTGTTCCTTTGATCTGGTCATACTTCTGGGAAATTCTTTTGGACACTGTAATGAT
GAAGGAGACCTACAGTCCCTCCGGGAGGCCTCTCGGGTCCTGAAACCAGGAGGAATTTTCGTCATTGACCACGTG
GATGGAGCATGGATTTGATCCAACTTCAGTCAAAGTGGATGGGAATGGCTTGAGGGCAAAGAAAAACTTCTGGCC
TGCCGGGAACGAGAGCTGTCTCCCGACAAAACCCTCCTCGCTAGCCGAGAGATTGTGATTGATTTGGAAGGTCCT
TCGATCCGCCAAGATCTTTTCTATTCCGTCAGACTTTACGATCTGGAGGAAATGGACAACCTTCTCCAAAGATCT
GGCCTATTCCTTCAAGCAGAAGATGGGATGCAGATCACAGCGACCAAGCGAGACGGCCCTGTGGACATGGGTATG
ATGGAACGCAGGCAGTTGATCGTTGCACAGAAGCCAGTCAAGTCCACAGCTGCCAAGCCCCCAGCTGTCGATGCT
CTGGAGCAAGACGCGGATATCTACGTGCATCCAAACCTGACACAAAGCTACAATCCTCACAAAGGAAGATTGCTA
CAAGTCTCGGCATTTGTGTCAGCCGGTACCATGATTCTGGCAGATACACCATATGCTTTGATCCCGTCTGCGGAT
CCATCCCATCCTGATGCCTCGATTTGCAGTAACCTGAAATGCCGCCAACAAGTGTCACGGGACACACATAGAGAG
ATTTGCCAAAGGAATTGCATCCGGGATGTTGTTTGGTGTGACAATCGTTGTCGGACGGCAGACCAGGCTCGGCAT
GACTTTGAATGCGCTTGGTTGAAAAACTACGGAGAAAGTCTTCGTCAAAACGAGGGCCAGTATGCATTTGCCATG
CTTTGGACAGTCATGCGTCTTCTAGCTGGAAGGTACATTGAGTTACAGGCAGGGTTCAAGCCATCTGAGCTCTAT
TCCTGGGAAGATCGGTTCAAGCGGGGGTGGGATTCCATTGAGATCCTCCACAGTAACCGGGAGAGGTGGCCTCAG
ACGCAGATTTTGCACTGGAAGAGGCTAGTTGAGGTATATCTAACTCACGATAATCAGTCAGACCTTAGCGTTGAT
GATCTAGTGGATCTCATCTGCAAAGAAGAGTCTAATTCGTTCGGGCTATATCCAAGTGACACTGGGATATTTCCC
ATTCCGGACCCCCCAATCGAACGAGGCGTGGATTATGGCTTGGGTATCTACCCAAGAGCCTCTATAGTCAACCAT
TCCTGCATTCCAAATGTAAGTTACCCCTCGAGAATACTAGATTTCAAACATACTCAAATATCCTAGGTCATCTGG
AGAGCAGACAACAATGGGCGGATGGTATTGACTACCTCAAAAGATCTTGCCGCAGGCGACGAGTGCTTTATTTGC
TATTTTGATCTATGCAAATATGTAGATTTCAAAGCACGGCAAAAGCTGCTGCGAGAAGACTTCCTATTCTCTTGC
GCCTGTGAGCGATGCACTCAAGAACAGGCCGAGGAAATATATGGCCGCTTAGAGTAGCAGTTAGGTCTACCACGT
TCAATTGCAAAACAACTTAAGATGACCGAAAAATATAATGTAACTGATCTTCTGGGTAAGATCCACCGTCAAGGG
CTGTCTGTATATAAGATCACTGAAGACTCTTGCCTCTGCTCGTGGGGGCTTGGGCCCTTGGGGACATCAGTCAGA
GACCTGGAGATGCTCATGAAAGTCTGACCAATGCAGAAGACATGTGAATTTAATTATTCCACCTTGTTTCCTCCA
AGTCCGCCCTACGACTCGGGCTCATCCACCACACAATCCAACAATTCTGCGATGCTTTGAACCTTCACATGTACT
CGATGGATCCAGCTCGGACTCTGCCAGTGGGGGAACCAAACAACCTCATGATCTACCTGGCGTGATGCCCTATAC
TCCTCTGAAATGTGATGGATATACGTTGGCCTTTTCTATTCTCACGGCATTATACTAATTCTTCAAAGAACACAA
CCTGCGCCATTCCGTATTTAGGATGATTGGTGGAATGTCGTCACTCCATTCATGAATCCCAAGCAAATCACTTTC
CTGCATTGAGGAATTCCCACCAATGGGAGGAATGAGTGTATCAACCCACATGTGAGAGCTATAAGTTTATATGAA
AACACTTCTTTCGCGGAGAATGACTCTAACCCCAATAACTCACAAAGGTTGCATCCATGTACACAATAATGGACG
TGATCTGGAAAGCAACCGGAGTAGCCCTCCTCAGTATCCTATCTTACGTTCAGGCATATCCTTCCAGTGCATTTG
CATCCTCGCATAAGACTCCATTTTTTTGTTTTGGTGGGTGATAGCACCACGGCAACTCAATCCTCGAACGGAGGA
GGATGGGGAGATGGACTTCTCAATACAACCCTTTTCAAAGGAGCATCTGGTCGCAATTTCGGTCACAACGGTGCA
ACCACTGTTAGCTTCCGGAGCGGAGGTTATTGGGACGAGGTTCTAACAACCGTGAGACAAGTTCGAGACGACTAT
CATCCACTTGTTACAATCCAATTCGGCCACGACGACCAAAAGCCCGCAGCAAACATTTCATTATCACAATACACC
AGGAATCTTGAAAGATTCGTGACTGAGGCCTCTAATGCTGGGGCTACACCGATTCTCGTCACTCCTCTATCTCGG
CGCAACTACGATAAATCAACAGGGACACCGCGTATCGTCATGAGTCTCGCCAATGAGACCTTGGCCACCATCATT
GCCGCTCATCGCTCAAACGCTGCCTATATTGATCTGAATAAAACTAGCACCTGGTATCTCAATGCAATCGGGCCA
GAAAATGCTTTTACATACAACCTCAACCCAGCGGATTATACCCATTTGAACGTGCCGGGGAGCATTTTGTTTGGG
GGAATTGTGGCCGAACTTATTACGCAGAAACTTGGGACTCTGGAAAAGTCTGGATATCTGCGCGTGAATGACAAA
CTGAAGAAGAATGTTGATTATGGGATCTATTACTGGCCTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail