Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g9042.t1
Gene name
Locationscaffold_40:146833..148670
Strand+
Gene length (bp)1837
Transcript length (bp)1662
Coding sequence length (bp)1662
Protein length (aa) 554

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03062 MBOAT MBOAT, membrane-bound O-acyltransferase family 8.2E-53 121 435

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 40 0.5

Transmembrane Domains

Domain # Start End Length
1 52 69 17
2 84 106 22
3 227 249 22
4 371 390 19
5 422 444 22
6 454 476 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g9042.t1
MLPYVDQIFEVPAKLTGASTDELKLIGSFLLSYPLAALLKRIPDGQPWKKNVFIIAVSLFYIIGLFDLWDGLRTL
LYSAAATYAIAYYVDGSLMPWIGFLFLMGHMSINHIDRQRANDKSAVDITGAQMVMVMKLSSFCWNIHDGRLPKD
QLSDSQKYSAITKFPGIVDYLGYVLFFPSLFAGPSFEYVDYRRWIDTTLFEVPPGTDPSKVPATRKKRKIPRSGR
PAALKAAAGLVWIFAFIQLSSYFTTDFVLSDAFLQYSFLRRVFTVFMLGFTARTKYYGVWALTEGACILSGMGYN
SFDPKTGKVFWNRLQNVDPWAMETAQNSHAYLANWNKNTNHWLRNYVYLRVTPKGKKPGFRASLATFATSALWHG
FHPGYYMTFILGSFIQTAAKNFRRYVRPFFLTPDGTKPTPNKPYYDILSWLATQLTLSFAVIPFIILNFDDSVTV
WSRLYFYGILNCAVSLVAFASFSPLRKYLVSQLKHRSRPNAVSTDTVLPPDLGLPNDPERDFDEAVAEIKAEIES
RGRRGSTVKMPTGAELKAAVEQKLGRKL*
Coding >Pro_DTO377G3_2|g9042.t1
ATGTTGCCCTATGTAGATCAGATATTTGAGGTGCCAGCTAAACTCACTGGCGCATCAACTGATGAGCTCAAGCTG
ATCGGCTCGTTCCTCCTCTCCTACCCACTGGCCGCCCTCCTCAAACGTATCCCCGATGGCCAACCCTGGAAGAAG
AATGTCTTCATTATCGCCGTTTCGTTGTTCTATATTATCGGACTCTTCGACCTCTGGGATGGTCTACGCACCTTA
CTATACAGTGCCGCGGCTACCTATGCAATCGCCTACTACGTGGATGGATCACTGATGCCGTGGATTGGGTTCCTT
TTCCTGATGGGCCACATGTCGATTAACCATATCGATCGTCAGAGGGCGAACGACAAATCGGCCGTTGACATTACT
GGAGCGCAGATGGTCATGGTCATGAAACTTAGCTCATTCTGCTGGAACATTCATGACGGCCGTCTGCCCAAGGAC
CAACTCTCGGATTCGCAGAAGTACTCTGCTATTACGAAATTCCCGGGTATTGTAGACTATCTGGGCTATGTCTTG
TTCTTCCCTTCTCTCTTTGCCGGTCCTTCCTTTGAATACGTGGATTATCGCCGTTGGATCGACACTACGCTCTTT
GAAGTTCCGCCAGGCACTGACCCATCCAAGGTGCCAGCTACCCGGAAGAAGCGTAAGATCCCTCGCAGCGGAAGA
CCTGCTGCACTGAAGGCCGCCGCCGGGTTGGTCTGGATCTTCGCCTTCATCCAACTGAGCTCATACTTCACCACC
GACTTTGTGCTTTCAGACGCCTTCTTGCAGTATTCCTTCCTGCGTCGCGTTTTCACTGTCTTCATGCTGGGTTTC
ACCGCTCGCACCAAGTATTACGGCGTCTGGGCTCTGACTGAGGGTGCCTGTATTCTATCCGGCATGGGATACAAC
AGCTTCGACCCGAAAACAGGCAAGGTCTTCTGGAATCGACTGCAGAATGTCGATCCGTGGGCGATGGAAACGGCA
CAGAATTCCCATGCTTACCTAGCCAACTGGAACAAGAACACCAACCACTGGCTGCGCAACTACGTCTACCTCCGC
GTTACGCCGAAGGGCAAGAAACCGGGCTTCCGCGCTAGCCTGGCTACCTTCGCCACCAGCGCCCTCTGGCACGGT
TTCCACCCAGGATACTACATGACCTTTATACTGGGCTCGTTTATCCAGACCGCGGCAAAGAACTTCCGCCGCTAC
GTGCGCCCCTTCTTCCTCACACCGGACGGCACCAAGCCAACACCAAACAAGCCCTACTACGACATCCTCAGCTGG
CTGGCAACACAGCTGACCCTTTCCTTCGCCGTCATCCCCTTTATCATCCTCAACTTCGACGACTCCGTCACCGTC
TGGTCCCGCCTCTACTTCTACGGCATCCTTAACTGCGCCGTTTCCCTAGTTGCCTTCGCCTCCTTCTCCCCGCTC
AGAAAATACCTCGTCTCTCAACTGAAGCACCGCAGCCGTCCTAACGCCGTAAGCACCGACACCGTGCTTCCACCT
GACCTAGGCCTGCCGAATGATCCCGAGCGTGACTTTGACGAGGCTGTTGCTGAGATCAAGGCTGAGATCGAGTCC
CGTGGTAGACGTGGAAGTACGGTTAAGATGCCTACAGGCGCGGAGCTGAAGGCTGCCGTTGAGCAAAAGCTTGGG
CGGAAGTTGTAG
Transcript >Pro_DTO377G3_2|g9042.t1
ATGTTGCCCTATGTAGATCAGATATTTGAGGTGCCAGCTAAACTCACTGGCGCATCAACTGATGAGCTCAAGCTG
ATCGGCTCGTTCCTCCTCTCCTACCCACTGGCCGCCCTCCTCAAACGTATCCCCGATGGCCAACCCTGGAAGAAG
AATGTCTTCATTATCGCCGTTTCGTTGTTCTATATTATCGGACTCTTCGACCTCTGGGATGGTCTACGCACCTTA
CTATACAGTGCCGCGGCTACCTATGCAATCGCCTACTACGTGGATGGATCACTGATGCCGTGGATTGGGTTCCTT
TTCCTGATGGGCCACATGTCGATTAACCATATCGATCGTCAGAGGGCGAACGACAAATCGGCCGTTGACATTACT
GGAGCGCAGATGGTCATGGTCATGAAACTTAGCTCATTCTGCTGGAACATTCATGACGGCCGTCTGCCCAAGGAC
CAACTCTCGGATTCGCAGAAGTACTCTGCTATTACGAAATTCCCGGGTATTGTAGACTATCTGGGCTATGTCTTG
TTCTTCCCTTCTCTCTTTGCCGGTCCTTCCTTTGAATACGTGGATTATCGCCGTTGGATCGACACTACGCTCTTT
GAAGTTCCGCCAGGCACTGACCCATCCAAGGTGCCAGCTACCCGGAAGAAGCGTAAGATCCCTCGCAGCGGAAGA
CCTGCTGCACTGAAGGCCGCCGCCGGGTTGGTCTGGATCTTCGCCTTCATCCAACTGAGCTCATACTTCACCACC
GACTTTGTGCTTTCAGACGCCTTCTTGCAGTATTCCTTCCTGCGTCGCGTTTTCACTGTCTTCATGCTGGGTTTC
ACCGCTCGCACCAAGTATTACGGCGTCTGGGCTCTGACTGAGGGTGCCTGTATTCTATCCGGCATGGGATACAAC
AGCTTCGACCCGAAAACAGGCAAGGTCTTCTGGAATCGACTGCAGAATGTCGATCCGTGGGCGATGGAAACGGCA
CAGAATTCCCATGCTTACCTAGCCAACTGGAACAAGAACACCAACCACTGGCTGCGCAACTACGTCTACCTCCGC
GTTACGCCGAAGGGCAAGAAACCGGGCTTCCGCGCTAGCCTGGCTACCTTCGCCACCAGCGCCCTCTGGCACGGT
TTCCACCCAGGATACTACATGACCTTTATACTGGGCTCGTTTATCCAGACCGCGGCAAAGAACTTCCGCCGCTAC
GTGCGCCCCTTCTTCCTCACACCGGACGGCACCAAGCCAACACCAAACAAGCCCTACTACGACATCCTCAGCTGG
CTGGCAACACAGCTGACCCTTTCCTTCGCCGTCATCCCCTTTATCATCCTCAACTTCGACGACTCCGTCACCGTC
TGGTCCCGCCTCTACTTCTACGGCATCCTTAACTGCGCCGTTTCCCTAGTTGCCTTCGCCTCCTTCTCCCCGCTC
AGAAAATACCTCGTCTCTCAACTGAAGCACCGCAGCCGTCCTAACGCCGTAAGCACCGACACCGTGCTTCCACCT
GACCTAGGCCTGCCGAATGATCCCGAGCGTGACTTTGACGAGGCTGTTGCTGAGATCAAGGCTGAGATCGAGTCC
CGTGGTAGACGTGGAAGTACGGTTAAGATGCCTACAGGCGCGGAGCTGAAGGCTGCCGTTGAGCAAAAGCTTGGG
CGGAAGTTGTAG
Gene >Pro_DTO377G3_2|g9042.t1
ATGTTGCCCTATGTAGATCAGAGTATGTCAACCCTCATTCAAACTTGGGAAGCTCGGTCTAACTAACACTTCTCC
CCGCAGTATTTGAGGTGCCAGCTAAACTCACTGGCGCATCAACTGATGAGCGTACGATCTTCCATTTCCATAAGC
TCCCGAATTGCTAGCAATTGCTGACCCCCAGCTCCAGTCAAGCTGATCGGCTCGTTCCTCCTCTCCTACCCACTG
GCCGCCCTCCTCAAACGTATCCCCGATGGCCAACCCTGGAAGAAGAATGTCTTCATTATCGCCGTTTCGTTGTTC
TATATTATCGGACTCTTCGACCTCTGGGATGGTCTACGCACCTTACTATACAGTGCCGCGGCTACCTATGCAATC
GCCTACTACGTGGATGGATCACTGATGCCGTGGATTGGGTTCCTTTTCCTGATGGGCCACATGTCGATTAACCAT
ATCGATCGTCAGAGGGCGAACGACAAATCGGCCGTTGACATTACTGGAGCGCAGATGGTCATGGTCATGAAACTT
AGCTCATTCTGCTGGAACATTCATGACGGCCGTCTGCCCAAGGACCAACTCTCGGATTCGCAGAAGTACTCTGCT
ATTACGAAATTCCCGGGTATTGTAGACTATCTGGGCTATGTCTTGTTCTTCCCTTCTCTCTTTGCCGGTCCTTCC
TTTGAATACGTGGATTATCGCCGTTGGATCGACACTACGCTCTTTGAAGTTCCGCCAGGCACTGACCCATCCAAG
GTGCCAGCTACCCGGAAGAAGCGTAAGATCCCTCGCAGCGGAAGACCTGCTGCACTGAAGGCCGCCGCCGGGTTG
GTCTGGATCTTCGCCTTCATCCAACTGAGCTCATACTTCACCACCGACTTTGTGCTTTCAGACGCCTTCTTGCAG
TATTCCTTCCTGCGTCGCGTTTTCACTGTCTTCATGCTGGGTTTCACCGCTCGCACCAAGTATTACGGCGTCTGG
GCTCTGACTGAGGGTGCCTGTATTCTATCCGGCATGGGATACAACAGCTTCGACCCGAAAACAGGCAAGGTCTTC
TGGAATCGACTGCAGAATGTCGATCCGTGGGCGATGGAAACGGCACAGAATTCCCATGCTTACCTAGCCAACTGG
AACAAGAACACCAACCACTGGCTGCGCAACTACGTCTACCTCCGCGTTACGCCGAAGGGCAAGAAACCGGGCTTC
CGCGCTAGCCTGGCTACCTTCGCCACCAGCGCCCTCTGGCACGGTTTCCACCCAGGATACTACATGACCTTTATA
CTGGGCTCGTTTATCCAGACCGCGGCAAAGAGTAAGCACCAATACACCTCCATAATCCACTCCCTCCATAACTTA
CCATTCAATAGACTTCCGCCGCTACGTGCGCCCCTTCTTCCTCACACCGGACGGCACCAAGCCAACACCAAACAA
GCCCTACTACGACATCCTCAGCTGGCTGGCAACACAGCTGACCCTTTCCTTCGCCGTCATCCCCTTTATCATCCT
CAACTTCGACGACTCCGTCACCGTCTGGTCCCGCCTCTACTTCTACGGCATCCTTAACTGCGCCGTTTCCCTAGT
TGCCTTCGCCTCCTTCTCCCCGCTCAGAAAATACCTCGTCTCTCAACTGAAGCACCGCAGCCGTCCTAACGCCGT
AAGCACCGACACCGTGCTTCCACCTGACCTAGGCCTGCCGAATGATCCCGAGCGTGACTTTGACGAGGCTGTTGC
TGAGATCAAGGCTGAGATCGAGTCCCGTGGTAGACGTGGAAGTACGGTTAAGATGCCTACAGGCGCGGAGCTGAA
GGCTGCCGTTGAGCAAAAGCTTGGGCGGAAGTTGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail