Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g9040.t1
Gene name
Locationscaffold_40:143328..144470
Strand-
Gene length (bp)1142
Transcript length (bp)1089
Coding sequence length (bp)1089
Protein length (aa) 363

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00106 adh_short short chain dehydrogenase 1.8E-32 41 218
PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase 5.5E-21 49 219
PF08659 KR KR domain 4.8E-11 40 197
PF01370 Epimerase NAD dependent epimerase/dehydratase family 5.5E-06 41 177

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 53 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 63.40 37.29 89.52
5d_25C Five days - 25 degrees Celsius 48.33 27.36 69.31
7d_25C Seven days - 25 degrees Celsius 41.26 22.64 59.88
10d_25C Ten days - 25 degrees Celsius 35.73 18.80 52.65
7d_15C Seven days - 15 degrees Celsius 48.26 27.11 69.41
7d_30C Seven days - 30 degrees Celsius 43.74 24.21 63.28

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.272795 no
3d_25C 7d_25C 0.064169 no
3d_25C 7d_15C 0.285957 no
3d_25C 7d_30C 0.133313 no
3d_25C 10d_25C 0.017762 yes
5d_25C 7d_25C 0.599644 no
5d_25C 7d_15C 0.996958 no
5d_25C 7d_30C 0.761465 no
5d_25C 10d_25C 0.260202 no
7d_25C 7d_15C 0.613556 no
7d_25C 7d_30C 0.875587 no
7d_25C 10d_25C 0.657428 no
7d_15C 7d_30C 0.775336 no
7d_15C 10d_25C 0.277425 no
7d_30C 10d_25C 0.507758 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g9040.t1
MEQTSPKGGPSSPASREPRLHLPSTTDPPGPQNPAKPLVWLIFGATGHMGRSLVKTALANNDLVAAVGRTYENSP
AAMKELESANCIGLLCDVRARETVKRVIDQTITRFGRIDIIANCSGYGVIGACEDQDEFDIRNQFETNFTGTLNM
IQLSLPHFRQRRAGRYLIFSSTSGALGVPGLGPYCASKYAVEGLMESMLYEVDSFNIKGTLVEPGHMRRDDIGDL
VSPSAVVPNPSEHQLSSPLPLYGHFLVKPPSEPYNTVTSPAAHARRMLMWLGDKQPASAVKAAHLVWQLGHCSYP
PLRLILGTYAVESIRDRLKCIIEEIEDWKYLSFPMGETLPVGGRGGSSFPEGAEGGSELGNG*
Coding >Pro_DTO377G3_2|g9040.t1
ATGGAGCAGACATCCCCAAAAGGAGGTCCCTCCTCTCCAGCATCACGCGAACCAAGACTTCATCTCCCTTCAACA
ACCGATCCCCCGGGTCCCCAGAACCCCGCCAAACCGCTCGTATGGCTGATCTTCGGCGCAACCGGCCACATGGGC
CGCTCCCTAGTAAAAACCGCCCTCGCCAACAATGACCTAGTAGCAGCCGTCGGACGCACCTACGAGAACAGCCCC
GCAGCAATGAAAGAGCTAGAATCAGCCAACTGCATCGGACTCCTATGCGACGTACGAGCGCGAGAGACCGTCAAG
CGCGTAATTGACCAAACAATAACCCGCTTCGGCCGAATTGACATAATCGCAAACTGCTCCGGCTACGGCGTCATC
GGCGCCTGCGAAGACCAAGATGAATTCGACATCCGCAACCAGTTCGAAACAAACTTCACAGGAACCCTGAACATG
ATCCAGCTCTCGCTACCGCATTTCCGTCAGCGTCGCGCGGGGAGATACCTCATTTTCAGCTCGACGTCTGGCGCG
CTCGGTGTGCCGGGCCTCGGACCATACTGTGCATCCAAATACGCCGTCGAGGGCTTGATGGAGAGTATGCTGTAT
GAGGTGGATAGTTTTAATATTAAGGGTACGCTCGTTGAGCCTGGTCATATGCGTCGTGATGATATTGGGGATTTG
GTTTCGCCATCTGCGGTCGTGCCTAACCCTTCTGAACATCAGCTTTCGTCGCCCTTGCCGCTCTACGGCCATTTT
CTGGTTAAGCCGCCCAGTGAGCCGTATAATACGGTTACGTCGCCGGCGGCGCATGCGCGACGTATGCTCATGTGG
CTGGGCGATAAGCAGCCTGCTAGTGCGGTAAAGGCGGCGCATTTGGTTTGGCAGCTTGGTCATTGCTCTTACCCG
CCTCTGAGGCTGATTCTGGGTACGTATGCTGTTGAGAGTATACGGGATCGGTTGAAGTGTATTATTGAGGAGATT
GAGGATTGGAAATATCTCAGTTTCCCGATGGGTGAGACTTTGCCGGTTGGAGGGCGTGGGGGATCTTCTTTTCCG
GAGGGAGCTGAAGGGGGGAGCGAATTGGGTAATGGATAA
Transcript >Pro_DTO377G3_2|g9040.t1
ATGGAGCAGACATCCCCAAAAGGAGGTCCCTCCTCTCCAGCATCACGCGAACCAAGACTTCATCTCCCTTCAACA
ACCGATCCCCCGGGTCCCCAGAACCCCGCCAAACCGCTCGTATGGCTGATCTTCGGCGCAACCGGCCACATGGGC
CGCTCCCTAGTAAAAACCGCCCTCGCCAACAATGACCTAGTAGCAGCCGTCGGACGCACCTACGAGAACAGCCCC
GCAGCAATGAAAGAGCTAGAATCAGCCAACTGCATCGGACTCCTATGCGACGTACGAGCGCGAGAGACCGTCAAG
CGCGTAATTGACCAAACAATAACCCGCTTCGGCCGAATTGACATAATCGCAAACTGCTCCGGCTACGGCGTCATC
GGCGCCTGCGAAGACCAAGATGAATTCGACATCCGCAACCAGTTCGAAACAAACTTCACAGGAACCCTGAACATG
ATCCAGCTCTCGCTACCGCATTTCCGTCAGCGTCGCGCGGGGAGATACCTCATTTTCAGCTCGACGTCTGGCGCG
CTCGGTGTGCCGGGCCTCGGACCATACTGTGCATCCAAATACGCCGTCGAGGGCTTGATGGAGAGTATGCTGTAT
GAGGTGGATAGTTTTAATATTAAGGGTACGCTCGTTGAGCCTGGTCATATGCGTCGTGATGATATTGGGGATTTG
GTTTCGCCATCTGCGGTCGTGCCTAACCCTTCTGAACATCAGCTTTCGTCGCCCTTGCCGCTCTACGGCCATTTT
CTGGTTAAGCCGCCCAGTGAGCCGTATAATACGGTTACGTCGCCGGCGGCGCATGCGCGACGTATGCTCATGTGG
CTGGGCGATAAGCAGCCTGCTAGTGCGGTAAAGGCGGCGCATTTGGTTTGGCAGCTTGGTCATTGCTCTTACCCG
CCTCTGAGGCTGATTCTGGGTACGTATGCTGTTGAGAGTATACGGGATCGGTTGAAGTGTATTATTGAGGAGATT
GAGGATTGGAAATATCTCAGTTTCCCGATGGGTGAGACTTTGCCGGTTGGAGGGCGTGGGGGATCTTCTTTTCCG
GAGGGAGCTGAAGGGGGGAGCGAATTGGGTAATGGATAA
Gene >Pro_DTO377G3_2|g9040.t1
ATGGAGCAGACATCCCCAAAAGGAGGTCCCTCCTCTCCAGCATCACGCGAACCAAGACTTCATCTCCCTTCAACA
ACCGATCCCCCGGGTCCCCAGAACCCCGCCAAACCGCTCGTATGGCTGGTATACAACCCCTCCCTAAGCAAAAAC
CCCAAGAAACACTAACACACCCCCAGATCTTCGGCGCAACCGGCCACATGGGCCGCTCCCTAGTAAAAACCGCCC
TCGCCAACAATGACCTAGTAGCAGCCGTCGGACGCACCTACGAGAACAGCCCCGCAGCAATGAAAGAGCTAGAAT
CAGCCAACTGCATCGGACTCCTATGCGACGTACGAGCGCGAGAGACCGTCAAGCGCGTAATTGACCAAACAATAA
CCCGCTTCGGCCGAATTGACATAATCGCAAACTGCTCCGGCTACGGCGTCATCGGCGCCTGCGAAGACCAAGATG
AATTCGACATCCGCAACCAGTTCGAAACAAACTTCACAGGAACCCTGAACATGATCCAGCTCTCGCTACCGCATT
TCCGTCAGCGTCGCGCGGGGAGATACCTCATTTTCAGCTCGACGTCTGGCGCGCTCGGTGTGCCGGGCCTCGGAC
CATACTGTGCATCCAAATACGCCGTCGAGGGCTTGATGGAGAGTATGCTGTATGAGGTGGATAGTTTTAATATTA
AGGGTACGCTCGTTGAGCCTGGTCATATGCGTCGTGATGATATTGGGGATTTGGTTTCGCCATCTGCGGTCGTGC
CTAACCCTTCTGAACATCAGCTTTCGTCGCCCTTGCCGCTCTACGGCCATTTTCTGGTTAAGCCGCCCAGTGAGC
CGTATAATACGGTTACGTCGCCGGCGGCGCATGCGCGACGTATGCTCATGTGGCTGGGCGATAAGCAGCCTGCTA
GTGCGGTAAAGGCGGCGCATTTGGTTTGGCAGCTTGGTCATTGCTCTTACCCGCCTCTGAGGCTGATTCTGGGTA
CGTATGCTGTTGAGAGTATACGGGATCGGTTGAAGTGTATTATTGAGGAGATTGAGGATTGGAAATATCTCAGTT
TCCCGATGGGTGAGACTTTGCCGGTTGGAGGGCGTGGGGGATCTTCTTTTCCGGAGGGAGCTGAAGGGGGGAGCG
AATTGGGTAATGGATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail