Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g9038.t1
Gene name
Locationscaffold_40:137650..138798
Strand+
Gene length (bp)1148
Transcript length (bp)1083
Coding sequence length (bp)1083
Protein length (aa) 361

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06999 Suc_Fer-like Sucrase/ferredoxin-like 4.2E-60 77 349

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 24 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 22.80 10.94 34.65
5d_25C Five days - 25 degrees Celsius 17.86 7.95 27.77
7d_25C Seven days - 25 degrees Celsius 13.34 5.43 21.25
10d_25C Ten days - 25 degrees Celsius 8.66 3.03 14.30
7d_15C Seven days - 15 degrees Celsius 30.72 15.78 45.66
7d_30C Seven days - 30 degrees Celsius 8.55 2.79 14.32

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.490697 no
3d_25C 7d_25C 0.076091 no
3d_25C 7d_15C 0.333990 no
3d_25C 7d_30C 0.003197 yes
3d_25C 10d_25C 0.001278 yes
5d_25C 7d_25C 0.419225 no
5d_25C 7d_15C 0.060029 no
5d_25C 7d_30C 0.032406 yes
5d_25C 10d_25C 0.025371 yes
7d_25C 7d_15C 0.001804 yes
7d_25C 7d_30C 0.235776 no
7d_25C 10d_25C 0.231120 no
7d_15C 7d_30C 0.000700 yes
7d_15C 10d_25C 0.000700 yes
7d_30C 10d_25C 0.984214 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g9038.t1
MRPILVQSLKRDWSGRTYRNCQTIRLLSTPQRSSRLRARLEIPPPFPITKTCPEPSCNCPPTPALPEDLPIDYEQ
ALNGTMAAYAQQLLVCTGQPDWTSRIENDGENKGWGNLVRGLKSLLGRGGPYLDPFNNILVTNSSITPAAGSSST
SASVFLFPSFKYIPSIPVNTTSSPDQTTDLTTFVRAYLLPERLHNMHSSLSATKQAQMTRSPELASHFPGVIDIN
HSPTVLICGHGGRDMRCGLMAPALESEFKRVLQARGFTSADSDGTTVDGPKHANIGLISHVGGHKYAGNVIIYIP
PKMIVGTSSEPHPLAGKGIWYGRIEPKHVEGLVEETILGGKVIADHFRGGIDRSGDILRM*
Coding >Pro_DTO377G3_2|g9038.t1
ATGCGACCAATACTTGTGCAATCGCTCAAGCGCGACTGGAGCGGGCGAACCTATCGAAACTGCCAGACAATCCGT
CTACTGTCTACCCCTCAGCGCAGTAGCAGACTCCGCGCCCGCCTAGAAATCCCCCCTCCCTTCCCCATTACCAAG
ACATGCCCCGAACCAAGCTGCAATTGTCCGCCCACGCCCGCTCTACCGGAGGATCTACCGATTGATTATGAACAA
GCCTTAAATGGGACGATGGCTGCCTACGCGCAGCAGCTTCTCGTCTGCACGGGACAGCCAGACTGGACGAGTCGC
ATTGAGAATGATGGGGAAAACAAAGGCTGGGGTAACCTTGTGAGAGGATTGAAGAGCCTGCTAGGTCGTGGCGGG
CCATATCTTGATCCTTTCAACAATATCTTGGTCACAAATTCATCTATCACACCAGCTGCAGGATCCTCCTCCACC
TCTGCCTCGGTGTTCCTCTTCCCCAGCTTCAAATACATTCCCTCAATACCCGTGAACACAACCTCATCGCCCGAC
CAAACAACCGACCTTACGACCTTCGTGCGCGCATATCTTCTCCCTGAACGACTCCACAACATGCACTCCTCTCTC
TCCGCAACCAAACAAGCACAAATGACCCGATCCCCGGAGCTAGCATCACACTTCCCAGGCGTTATCGATATCAAT
CACTCTCCAACAGTGTTAATATGTGGACACGGAGGTCGCGACATGCGCTGTGGTCTCATGGCCCCCGCGTTGGAA
AGCGAGTTCAAGCGCGTGTTGCAAGCGCGAGGATTCACTTCCGCAGACAGTGATGGGACTACGGTGGATGGCCCT
AAGCACGCTAATATTGGTCTGATCAGTCATGTTGGAGGACACAAATACGCAGGCAATGTGATTATTTATATACCA
CCGAAGATGATAGTGGGAACTTCTTCGGAGCCACACCCGCTGGCGGGTAAGGGGATTTGGTACGGTCGTATTGAG
CCCAAGCATGTGGAGGGGCTTGTCGAGGAGACTATTCTCGGAGGGAAAGTGATTGCGGATCATTTCCGGGGTGGC
ATTGATAGGAGTGGTGATATTTTGAGAATGTAG
Transcript >Pro_DTO377G3_2|g9038.t1
ATGCGACCAATACTTGTGCAATCGCTCAAGCGCGACTGGAGCGGGCGAACCTATCGAAACTGCCAGACAATCCGT
CTACTGTCTACCCCTCAGCGCAGTAGCAGACTCCGCGCCCGCCTAGAAATCCCCCCTCCCTTCCCCATTACCAAG
ACATGCCCCGAACCAAGCTGCAATTGTCCGCCCACGCCCGCTCTACCGGAGGATCTACCGATTGATTATGAACAA
GCCTTAAATGGGACGATGGCTGCCTACGCGCAGCAGCTTCTCGTCTGCACGGGACAGCCAGACTGGACGAGTCGC
ATTGAGAATGATGGGGAAAACAAAGGCTGGGGTAACCTTGTGAGAGGATTGAAGAGCCTGCTAGGTCGTGGCGGG
CCATATCTTGATCCTTTCAACAATATCTTGGTCACAAATTCATCTATCACACCAGCTGCAGGATCCTCCTCCACC
TCTGCCTCGGTGTTCCTCTTCCCCAGCTTCAAATACATTCCCTCAATACCCGTGAACACAACCTCATCGCCCGAC
CAAACAACCGACCTTACGACCTTCGTGCGCGCATATCTTCTCCCTGAACGACTCCACAACATGCACTCCTCTCTC
TCCGCAACCAAACAAGCACAAATGACCCGATCCCCGGAGCTAGCATCACACTTCCCAGGCGTTATCGATATCAAT
CACTCTCCAACAGTGTTAATATGTGGACACGGAGGTCGCGACATGCGCTGTGGTCTCATGGCCCCCGCGTTGGAA
AGCGAGTTCAAGCGCGTGTTGCAAGCGCGAGGATTCACTTCCGCAGACAGTGATGGGACTACGGTGGATGGCCCT
AAGCACGCTAATATTGGTCTGATCAGTCATGTTGGAGGACACAAATACGCAGGCAATGTGATTATTTATATACCA
CCGAAGATGATAGTGGGAACTTCTTCGGAGCCACACCCGCTGGCGGGTAAGGGGATTTGGTACGGTCGTATTGAG
CCCAAGCATGTGGAGGGGCTTGTCGAGGAGACTATTCTCGGAGGGAAAGTGATTGCGGATCATTTCCGGGGTGGC
ATTGATAGGAGTGGTGATATTTTGAGAATGTAG
Gene >Pro_DTO377G3_2|g9038.t1
ATGCGACCAATACTTGTGCAATCGCTCAAGCGCGACTGGAGCGGGCGAACCTATCGAAACTGCCAGACAATCCGT
CTACTGTCTACCCCTCAGCGCAGTAGCAGACTCCGCGCCCGCCTAGAAATCCCCCCTCCCTTCCCCATTACCAAG
ACATGCCCCGAACCAAGCTGCAATTGTCCGCCCACGCCCGCTCTACCGGAGGATCTACCGATTGATTATGAACAA
GCCTTAAATGGGACGATGGCTGCCTACGCGCAGCAGCTTCTCGTCTGCACGGGACAGCCAGACTGGACGAGTCGC
ATTGAGAATGATGGGGAAAACAAAGGCTGGGGTAACCTTGTGAGAGGATTGAAGAGCCTGCTAGGTCGTGGCGGG
CCATATCTTGATGTAAGTGGTTCAACTAACCCAATGAATGCGCAAGCTCTTGCTTATACAGGATCATATCGCTTT
AGCCTTTCAACAATATCTTGGTCACAAATTCATCTATCACACCAGCTGCAGGATCCTCCTCCACCTCTGCCTCGG
TGTTCCTCTTCCCCAGCTTCAAATACATTCCCTCAATACCCGTGAACACAACCTCATCGCCCGACCAAACAACCG
ACCTTACGACCTTCGTGCGCGCATATCTTCTCCCTGAACGACTCCACAACATGCACTCCTCTCTCTCCGCAACCA
AACAAGCACAAATGACCCGATCCCCGGAGCTAGCATCACACTTCCCAGGCGTTATCGATATCAATCACTCTCCAA
CAGTGTTAATATGTGGACACGGAGGTCGCGACATGCGCTGTGGTCTCATGGCCCCCGCGTTGGAAAGCGAGTTCA
AGCGCGTGTTGCAAGCGCGAGGATTCACTTCCGCAGACAGTGATGGGACTACGGTGGATGGCCCTAAGCACGCTA
ATATTGGTCTGATCAGTCATGTTGGAGGACACAAATACGCAGGCAATGTGATTATTTATATACCACCGAAGATGA
TAGTGGGAACTTCTTCGGAGCCACACCCGCTGGCGGGTAAGGGGATTTGGTACGGTCGTATTGAGCCCAAGCATG
TGGAGGGGCTTGTCGAGGAGACTATTCTCGGAGGGAAAGTGATTGCGGATCATTTCCGGGGTGGCATTGATAGGA
GTGGTGATATTTTGAGAATGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail