Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g9037.t1
Gene name
Locationscaffold_40:132350..133711
Strand-
Gene length (bp)1361
Transcript length (bp)1245
Coding sequence length (bp)1245
Protein length (aa) 415

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02826 2-Hacid_dh_C D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain 2.1E-51 180 364
PF00389 2-Hacid_dh D-isomer specific 2-hydroxyacid dehydrogenase, catalytic domain 3.2E-15 85 328

GO

GO Term Description Terminal node
GO:0016616 oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor Yes
GO:0051287 NAD binding Yes
GO:1901265 nucleoside phosphate binding No
GO:0016491 oxidoreductase activity No
GO:0097159 organic cyclic compound binding No
GO:0016614 oxidoreductase activity, acting on CH-OH group of donors No
GO:0005488 binding No
GO:0000166 nucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:0003674 molecular_function No
GO:0003824 catalytic activity No
GO:0036094 small molecule binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 27 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 344.50 205.16 483.84
5d_25C Five days - 25 degrees Celsius 228.64 139.07 318.20
7d_25C Seven days - 25 degrees Celsius 166.41 101.59 231.23
10d_25C Ten days - 25 degrees Celsius 146.51 89.38 203.65
7d_15C Seven days - 15 degrees Celsius 271.09 162.92 379.26
7d_30C Seven days - 30 degrees Celsius 169.77 103.56 235.97

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.058634 no
3d_25C 7d_25C 0.000700 yes
3d_25C 7d_15C 0.329336 no
3d_25C 7d_30C 0.000700 yes
3d_25C 10d_25C 0.000700 yes
5d_25C 7d_25C 0.145865 no
5d_25C 7d_15C 0.510872 no
5d_25C 7d_30C 0.175760 no
5d_25C 10d_25C 0.027737 yes
7d_25C 7d_15C 0.019353 yes
7d_25C 7d_30C 0.954424 no
7d_25C 10d_25C 0.646727 no
7d_15C 7d_30C 0.026584 yes
7d_15C 10d_25C 0.000700 yes
7d_30C 10d_25C 0.575342 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g9037.t1
MVFTRSLTRQLGRPFLSSSLKPTVASSSFARASPLAGYISGARTLTATSNLQGKVLLVLYDGGIHSQQQPQLLGT
TENELGIRKWLEDQGHTLVTTSDKDGENSTFDKELVDAEVIITTPFHPGYLTAERLAKAKKLKLAVTAGIGSDHV
DLNAANTTNGGITVAEVTGSNVVSVAEHVIMTILILVRNFVPAHEQIKAGDWNVAAVAKNEFDLENKVVGTVAVG
RIGERVLRRLKAFDCKELLYYDYQPLSPETEKEIGCRRVDDLEEMLAQCDVVTINCPLHEKTRGLFNKELISKMK
PGAWLVNTARGAIVVKEDVAEALKSGHLRGYGGDVWFPQPAPKDHPLRYAEHPWGGGNAMVPHMSGTSIDAQVRY
AEGTKNILESYFSGREDYRPQDLIVHKGAYATKAYGQRK*
Coding >Pro_DTO377G3_2|g9037.t1
ATGGTATTTACTCGCTCTCTTACCCGTCAATTAGGACGGCCCTTCCTCTCGAGCTCTCTCAAGCCAACTGTTGCC
TCCAGTTCCTTCGCTCGGGCTTCACCGTTGGCTGGCTATATTTCCGGTGCACGTACACTAACCGCAACTTCAAAC
CTCCAGGGCAAAGTTCTTTTGGTTCTTTACGATGGTGGTATTCACTCCCAGCAGCAGCCTCAGCTGCTCGGTACT
ACCGAGAATGAGCTCGGCATCCGCAAGTGGCTTGAGGACCAGGGTCACACCCTAGTGACCACCTCCGACAAGGAT
GGCGAGAACTCCACTTTCGACAAGGAGCTCGTCGATGCTGAAGTCATCATCACCACTCCCTTCCACCCAGGTTAC
CTCACCGCTGAGCGTCTGGCCAAGGCCAAGAAGCTCAAGCTCGCCGTCACTGCCGGTATTGGTTCCGATCACGTT
GACCTGAACGCTGCCAACACCACCAACGGCGGTATCACCGTCGCCGAGGTCACCGGATCTAACGTCGTCTCTGTC
GCTGAGCACGTTATCATGACCATCCTGATCTTGGTCCGCAACTTCGTCCCTGCCCACGAGCAGATCAAGGCCGGC
GACTGGAACGTCGCTGCCGTCGCCAAGAACGAGTTCGATCTTGAGAACAAGGTCGTCGGTACCGTCGCCGTCGGC
CGTATCGGTGAGCGTGTCCTCCGCCGCCTCAAGGCCTTCGACTGCAAGGAGCTCCTGTACTACGACTACCAGCCC
CTCTCCCCCGAGACCGAGAAGGAGATCGGCTGCCGTCGCGTCGACGATCTCGAGGAGATGCTCGCCCAGTGTGAC
GTTGTCACCATTAACTGCCCCCTGCACGAGAAGACCCGCGGTCTCTTCAACAAGGAGCTCATCTCCAAGATGAAG
CCCGGTGCTTGGCTCGTCAACACCGCTCGCGGTGCTATCGTTGTCAAGGAGGATGTCGCTGAGGCCCTCAAGTCT
GGTCACCTCCGTGGTTATGGTGGTGATGTCTGGTTCCCCCAGCCCGCCCCCAAGGACCACCCTCTCCGCTACGCC
GAGCACCCCTGGGGTGGCGGCAATGCCATGGTTCCCCACATGTCCGGTACCTCCATCGATGCTCAGGTCCGCTAC
GCCGAAGGTACCAAGAACATTCTCGAAAGCTACTTCTCCGGCCGTGAGGACTACCGCCCTCAGGACTTGATTGTT
CACAAGGGTGCCTATGCCACCAAGGCTTACGGTCAGCGCAAGTAG
Transcript >Pro_DTO377G3_2|g9037.t1
ATGGTATTTACTCGCTCTCTTACCCGTCAATTAGGACGGCCCTTCCTCTCGAGCTCTCTCAAGCCAACTGTTGCC
TCCAGTTCCTTCGCTCGGGCTTCACCGTTGGCTGGCTATATTTCCGGTGCACGTACACTAACCGCAACTTCAAAC
CTCCAGGGCAAAGTTCTTTTGGTTCTTTACGATGGTGGTATTCACTCCCAGCAGCAGCCTCAGCTGCTCGGTACT
ACCGAGAATGAGCTCGGCATCCGCAAGTGGCTTGAGGACCAGGGTCACACCCTAGTGACCACCTCCGACAAGGAT
GGCGAGAACTCCACTTTCGACAAGGAGCTCGTCGATGCTGAAGTCATCATCACCACTCCCTTCCACCCAGGTTAC
CTCACCGCTGAGCGTCTGGCCAAGGCCAAGAAGCTCAAGCTCGCCGTCACTGCCGGTATTGGTTCCGATCACGTT
GACCTGAACGCTGCCAACACCACCAACGGCGGTATCACCGTCGCCGAGGTCACCGGATCTAACGTCGTCTCTGTC
GCTGAGCACGTTATCATGACCATCCTGATCTTGGTCCGCAACTTCGTCCCTGCCCACGAGCAGATCAAGGCCGGC
GACTGGAACGTCGCTGCCGTCGCCAAGAACGAGTTCGATCTTGAGAACAAGGTCGTCGGTACCGTCGCCGTCGGC
CGTATCGGTGAGCGTGTCCTCCGCCGCCTCAAGGCCTTCGACTGCAAGGAGCTCCTGTACTACGACTACCAGCCC
CTCTCCCCCGAGACCGAGAAGGAGATCGGCTGCCGTCGCGTCGACGATCTCGAGGAGATGCTCGCCCAGTGTGAC
GTTGTCACCATTAACTGCCCCCTGCACGAGAAGACCCGCGGTCTCTTCAACAAGGAGCTCATCTCCAAGATGAAG
CCCGGTGCTTGGCTCGTCAACACCGCTCGCGGTGCTATCGTTGTCAAGGAGGATGTCGCTGAGGCCCTCAAGTCT
GGTCACCTCCGTGGTTATGGTGGTGATGTCTGGTTCCCCCAGCCCGCCCCCAAGGACCACCCTCTCCGCTACGCC
GAGCACCCCTGGGGTGGCGGCAATGCCATGGTTCCCCACATGTCCGGTACCTCCATCGATGCTCAGGTCCGCTAC
GCCGAAGGTACCAAGAACATTCTCGAAAGCTACTTCTCCGGCCGTGAGGACTACCGCCCTCAGGACTTGATTGTT
CACAAGGGTGCCTATGCCACCAAGGCTTACGGTCAGCGCAAGTAG
Gene >Pro_DTO377G3_2|g9037.t1
ATGGTATTTACTCGCTCTCTTACCCGTCAATTAGGACGGCCCTTCCTCTCGAGCTCTCTCAAGCCAACTGTTGCC
TCCAGTTCCTTCGCTCGGGCTTCACCGTTGGCTGGCTATATTTCCGGTGCACGTACACTAACCGCAACTTCAAAC
CTCCAGGGCAAAGTTCTTTTGGTTCTTTACGATGTAGGTCATTCTCACTTCATACTTCCTATACTTCAATCGCTG
ACCCGGTCTTGTTTGTGATATAGGGTGGTATTCACTCCCAGCAGCAGCCTCAGCTGCTCGGTACTACCGAGAATG
AGCTCGGCATCCGCAAGTGGCTTGAGGACCAGGGTCACACCCTAGTGACCACCTCCGACAAGGATGGCGAGAACT
CCACTTTCGACAAGGAGCTCGTCGATGCTGAAGTCATCATCACCACTCCGTTCGTTTCTGATGTGCATTATTTTA
AAAACCTCCACTGATTATATAACAGCTTCCACCCAGGTTACCTCACCGCTGAGCGTCTGGCCAAGGCCAAGAAGC
TCAAGCTCGCCGTCACTGCCGGTATTGGTTCCGATCACGTTGACCTGAACGCTGCCAACACCACCAACGGCGGTA
TCACCGTCGCCGAGGTCACCGGATCTAACGTCGTCTCTGTCGCTGAGCACGTTATCATGACCATCCTGATCTTGG
TCCGCAACTTCGTCCCTGCCCACGAGCAGATCAAGGCCGGCGACTGGAACGTCGCTGCCGTCGCCAAGAACGAGT
TCGATCTTGAGAACAAGGTCGTCGGTACCGTCGCCGTCGGCCGTATCGGTGAGCGTGTCCTCCGCCGCCTCAAGG
CCTTCGACTGCAAGGAGCTCCTGTACTACGACTACCAGCCCCTCTCCCCCGAGACCGAGAAGGAGATCGGCTGCC
GTCGCGTCGACGATCTCGAGGAGATGCTCGCCCAGTGTGACGTTGTCACCATTAACTGCCCCCTGCACGAGAAGA
CCCGCGGTCTCTTCAACAAGGAGCTCATCTCCAAGATGAAGCCCGGTGCTTGGCTCGTCAACACCGCTCGCGGTG
CTATCGTTGTCAAGGAGGATGTCGCTGAGGCCCTCAAGTCTGGTCACCTCCGTGGTTATGGTGGTGATGTCTGGT
TCCCCCAGCCCGCCCCCAAGGACCACCCTCTCCGCTACGCCGAGCACCCCTGGGGTGGCGGCAATGCCATGGTTC
CCCACATGTCCGGTACCTCCATCGATGCTCAGGTCCGCTACGCCGAAGGTACCAAGAACATTCTCGAAAGCTACT
TCTCCGGCCGTGAGGACTACCGCCCTCAGGACTTGATTGTTCACAAGGGTGCCTATGCCACCAAGGCTTACGGTC
AGCGCAAGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail