Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g9031.t1
Gene name
Locationscaffold_40:114038..115766
Strand+
Gene length (bp)1728
Transcript length (bp)1614
Coding sequence length (bp)1614
Protein length (aa) 538

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00201 UDPGT UDP-glucoronosyl and UDP-glucosyl transferase 3.5E-16 231 452

GO

GO Term Description Terminal node
GO:0016758 transferase activity, transferring hexosyl groups Yes
GO:0016757 transferase activity, transferring glycosyl groups No
GO:0003824 catalytic activity No
GO:0003674 molecular_function No
GO:0016740 transferase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 25 0.45

Transmembrane Domains

Domain # Start End Length
1 504 526 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g9031.t1
MSQSQIHLSRKILLVVTTGGFTHAAPVLEIGRVLAERGHEIEFATLEGQESWVKPEYDFVNKLHQLGPGPTPEQL
DGHYRRMQAWDISKGVGQAMESKYMFDSFWPQTYHRLKEIMDDPATRPDMIVADFFVEAANDIHFEYKVPIAIIC
PNMPLFQLPCPYIPGQPGFQLPGTMTSEDTSMWLRIMNEIFFFPDLPAIVRAGKWSKKMRSDNGVFYPPHKPSKP
DYLIFVNSFFGLEIPRDLPPTAAPVGPLLSPTYPPLDQQCGPFLARHKSVLYIALGTHIILPHKDAAKIVKAANR
LQEDGMIDGVIWAMGKTCRADLDRSASFQFNTGDKNEMEITLGDLLDNKHPNWIFPFFAPQRAILDNESTKLYFT
HGGGSSANEGLYHGKPMLSMGIFSDQIANTARLVAGGVAESLSKLNFTSDEVYTKAMKILKSENETYSRNVLRLQ
RIANVASRRKYHAADLIEELMYDNELRFKDGKELRPMHLQTADMRMSTFKARNWDLYAVSGLALSAVVGSMWLAG
RFALRYRGAVIG*
Coding >Pro_DTO377G3_2|g9031.t1
ATGAGCCAGTCCCAAATACATTTATCTAGAAAGATATTGCTGGTGGTTACTACCGGAGGATTCACACATGCCGCC
CCTGTTTTGGAAATTGGCCGGGTGCTCGCGGAGCGTGGCCACGAAATTGAATTTGCAACACTTGAGGGACAAGAG
AGCTGGGTGAAACCTGAGTATGACTTTGTCAACAAGCTTCATCAGTTAGGCCCCGGACCAACCCCCGAGCAACTC
GATGGTCACTATCGGCGTATGCAGGCATGGGATATCTCCAAGGGTGTCGGACAAGCTATGGAATCCAAATACATG
TTCGACTCCTTCTGGCCTCAAACCTACCATCGTCTCAAAGAGATCATGGATGACCCTGCGACTCGACCGGACATG
ATAGTTGCGGATTTCTTTGTCGAGGCAGCCAACGATATTCACTTTGAGTATAAGGTACCAATCGCCATCATCTGT
CCCAATATGCCTTTATTCCAGTTGCCCTGCCCGTACATCCCAGGCCAGCCAGGCTTCCAGCTTCCAGGGACCATG
ACATCCGAGGATACTTCCATGTGGCTACGAATCATGAACGAGATCTTCTTTTTTCCAGATCTACCAGCTATCGTA
CGCGCAGGAAAATGGAGCAAGAAGATGCGAAGCGACAATGGCGTCTTCTATCCGCCTCATAAGCCCAGCAAACCA
GACTATCTCATATTTGTCAACTCCTTCTTCGGGCTGGAAATCCCCCGCGATCTACCTCCAACTGCTGCTCCTGTT
GGTCCTCTCTTGAGTCCGACATACCCGCCACTAGACCAACAGTGCGGGCCATTCTTGGCCAGACATAAATCAGTT
CTTTATATCGCCCTTGGTACTCATATCATCCTGCCCCATAAGGATGCTGCGAAGATAGTGAAGGCCGCGAATCGC
CTCCAAGAGGATGGTATGATCGATGGTGTGATCTGGGCTATGGGCAAGACATGTCGAGCAGACCTTGACCGCAGC
GCATCCTTCCAATTCAACACAGGCGATAAAAATGAAATGGAAATCACCCTAGGGGATCTACTTGACAACAAACAT
CCGAATTGGATCTTCCCCTTTTTTGCACCTCAACGTGCTATCCTCGACAACGAATCAACCAAGCTCTACTTCACC
CATGGTGGAGGTTCTAGTGCTAACGAGGGTCTTTACCATGGAAAGCCAATGTTATCAATGGGTATCTTCTCGGAT
CAGATCGCCAACACCGCTCGGCTGGTCGCCGGAGGTGTCGCCGAGTCTTTGAGTAAACTCAACTTTACATCAGAT
GAGGTCTACACCAAAGCCATGAAGATTCTCAAATCAGAAAACGAGACATACAGCCGGAATGTGCTTCGCCTACAG
CGTATTGCTAATGTTGCTAGTCGTCGTAAGTATCATGCCGCCGATCTTATCGAGGAGCTCATGTACGACAATGAG
CTACGGTTCAAAGACGGCAAGGAATTGCGCCCGATGCACCTGCAGACGGCTGATATGCGTATGTCTACCTTTAAA
GCCAGGAACTGGGATCTCTATGCTGTCAGTGGACTGGCTCTATCTGCAGTTGTAGGATCGATGTGGTTGGCTGGT
CGCTTTGCGTTGCGGTATCGCGGCGCTGTGATCGGATAG
Transcript >Pro_DTO377G3_2|g9031.t1
ATGAGCCAGTCCCAAATACATTTATCTAGAAAGATATTGCTGGTGGTTACTACCGGAGGATTCACACATGCCGCC
CCTGTTTTGGAAATTGGCCGGGTGCTCGCGGAGCGTGGCCACGAAATTGAATTTGCAACACTTGAGGGACAAGAG
AGCTGGGTGAAACCTGAGTATGACTTTGTCAACAAGCTTCATCAGTTAGGCCCCGGACCAACCCCCGAGCAACTC
GATGGTCACTATCGGCGTATGCAGGCATGGGATATCTCCAAGGGTGTCGGACAAGCTATGGAATCCAAATACATG
TTCGACTCCTTCTGGCCTCAAACCTACCATCGTCTCAAAGAGATCATGGATGACCCTGCGACTCGACCGGACATG
ATAGTTGCGGATTTCTTTGTCGAGGCAGCCAACGATATTCACTTTGAGTATAAGGTACCAATCGCCATCATCTGT
CCCAATATGCCTTTATTCCAGTTGCCCTGCCCGTACATCCCAGGCCAGCCAGGCTTCCAGCTTCCAGGGACCATG
ACATCCGAGGATACTTCCATGTGGCTACGAATCATGAACGAGATCTTCTTTTTTCCAGATCTACCAGCTATCGTA
CGCGCAGGAAAATGGAGCAAGAAGATGCGAAGCGACAATGGCGTCTTCTATCCGCCTCATAAGCCCAGCAAACCA
GACTATCTCATATTTGTCAACTCCTTCTTCGGGCTGGAAATCCCCCGCGATCTACCTCCAACTGCTGCTCCTGTT
GGTCCTCTCTTGAGTCCGACATACCCGCCACTAGACCAACAGTGCGGGCCATTCTTGGCCAGACATAAATCAGTT
CTTTATATCGCCCTTGGTACTCATATCATCCTGCCCCATAAGGATGCTGCGAAGATAGTGAAGGCCGCGAATCGC
CTCCAAGAGGATGGTATGATCGATGGTGTGATCTGGGCTATGGGCAAGACATGTCGAGCAGACCTTGACCGCAGC
GCATCCTTCCAATTCAACACAGGCGATAAAAATGAAATGGAAATCACCCTAGGGGATCTACTTGACAACAAACAT
CCGAATTGGATCTTCCCCTTTTTTGCACCTCAACGTGCTATCCTCGACAACGAATCAACCAAGCTCTACTTCACC
CATGGTGGAGGTTCTAGTGCTAACGAGGGTCTTTACCATGGAAAGCCAATGTTATCAATGGGTATCTTCTCGGAT
CAGATCGCCAACACCGCTCGGCTGGTCGCCGGAGGTGTCGCCGAGTCTTTGAGTAAACTCAACTTTACATCAGAT
GAGGTCTACACCAAAGCCATGAAGATTCTCAAATCAGAAAACGAGACATACAGCCGGAATGTGCTTCGCCTACAG
CGTATTGCTAATGTTGCTAGTCGTCGTAAGTATCATGCCGCCGATCTTATCGAGGAGCTCATGTACGACAATGAG
CTACGGTTCAAAGACGGCAAGGAATTGCGCCCGATGCACCTGCAGACGGCTGATATGCGTATGTCTACCTTTAAA
GCCAGGAACTGGGATCTCTATGCTGTCAGTGGACTGGCTCTATCTGCAGTTGTAGGATCGATGTGGTTGGCTGGT
CGCTTTGCGTTGCGGTATCGCGGCGCTGTGATCGGATAG
Gene >Pro_DTO377G3_2|g9031.t1
ATGAGCCAGTCCCAAATACATTTATCTAGAAAGATATTGCTGGTGGTTACTACCGGAGGATTCACACATGCCGGT
AAGATGGAACATGAAACATGAACAGATAGACCACTAAATAAGAACCTATACAGCCCCTGTTTTGGAAATTGGCCG
GGTGCTCGCGGAGCGTGGCCACGAAATTGAATTTGCAACACTTGAGGGACAAGAGAGCTGGGTGAAACCTGAGTA
TGACTTTGTCAACAAGCTTCATCAGTTAGGCCCCGGACCAACCCCCGAGCAACTCGATGGTCACTATCGGCGTAT
GCAGGCATGGGATATCTCCAAGGGTGTCGGACAAGCTATGGAATCCAAATACATGTTCGACTCCTTCTGGCCTCA
AACCTACCATCGTCTCAAAGAGATCATGGATGACCCTGCGACTCGACCGGACATGATAGTTGCGGATTTCTTTGT
CGAGGCAGCCAACGATATTCACTTTGAGTATAAGGTACCAATCGCCATCATCTGTCCCAATATGCCTTTATTCCA
GTTGCCCTGCCCGTACATCCCAGGCCAGCCAGGCTTCCAGCTTCCAGGGACCATGACATCCGAGGATACTTCCAT
GTGGCTACGAATCATGAACGAGATCTTCTTTTTTCCAGATCTACCAGCTATCGTACGCGCAGGAAAATGGAGCAA
GAAGATGCGAAGCGACAATGGCGTCTTCTATCCGCCTCATAAGCCCAGCAAACCAGACTATCTCATATTTGTCAA
CTCCTTCTTCGGGCTGGAAATCCCCCGCGATCTACCTCCAACTGCTGCTCCTGTTGGTCCTCTCTTGAGTCCGAC
ATACCCGCCACTAGACCAACAGTGCGGGCCATTCTTGGCCAGACATAAATCAGTTCTTTATATCGCCCTTGGTAC
TCATATCATCCTGCCCCATAAGGATGCTGCGAAGATAGTGAAGGCCGCGAATCGCCTCCAAGAGGATGGTATGAT
CGATGGTGTGATCTGGGCTATGGGCAAGACATGTCGAGCAGACCTTGACCGCAGGTAAGAAACCCTACCATTAAA
GAATCAAATCTCTCTCCTCACGGCTAAAACCTTGCTAGCGCATCCTTCCAATTCAACACAGGCGATAAAAATGAA
ATGGAAATCACCCTAGGGGATCTACTTGACAACAAACATCCGAATTGGATCTTCCCCTTTTTTGCACCTCAACGT
GCTATCCTCGACAACGAATCAACCAAGCTCTACTTCACCCATGGTGGAGGTTCTAGTGCTAACGAGGGTCTTTAC
CATGGAAAGCCAATGTTATCAATGGGTATCTTCTCGGATCAGATCGCCAACACCGCTCGGCTGGTCGCCGGAGGT
GTCGCCGAGTCTTTGAGTAAACTCAACTTTACATCAGATGAGGTCTACACCAAAGCCATGAAGATTCTCAAATCA
GAAAACGAGACATACAGCCGGAATGTGCTTCGCCTACAGCGTATTGCTAATGTTGCTAGTCGTCGTAAGTATCAT
GCCGCCGATCTTATCGAGGAGCTCATGTACGACAATGAGCTACGGTTCAAAGACGGCAAGGAATTGCGCCCGATG
CACCTGCAGACGGCTGATATGCGTATGTCTACCTTTAAAGCCAGGAACTGGGATCTCTATGCTGTCAGTGGACTG
GCTCTATCTGCAGTTGTAGGATCGATGTGGTTGGCTGGTCGCTTTGCGTTGCGGTATCGCGGCGCTGTGATCGGA
TAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail