Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g9029.t1
Gene name
Locationscaffold_40:110181..111327
Strand+
Gene length (bp)1146
Transcript length (bp)1146
Coding sequence length (bp)1146
Protein length (aa) 382

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.5

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 23.98 11.90 36.06
5d_25C Five days - 25 degrees Celsius 19.50 9.07 29.94
7d_25C Seven days - 25 degrees Celsius 19.00 8.85 29.15
10d_25C Ten days - 25 degrees Celsius 13.95 5.90 21.99
7d_15C Seven days - 15 degrees Celsius 24.31 12.05 36.58
7d_30C Seven days - 30 degrees Celsius 16.26 7.25 25.27

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.556237 no
3d_25C 7d_25C 0.497305 no
3d_25C 7d_15C 0.976609 no
3d_25C 7d_30C 0.207293 no
3d_25C 10d_25C 0.076091 no
5d_25C 7d_25C 0.957758 no
5d_25C 7d_15C 0.516625 no
5d_25C 7d_30C 0.640069 no
5d_25C 10d_25C 0.339234 no
7d_25C 7d_15C 0.459870 no
7d_25C 7d_30C 0.694672 no
7d_25C 10d_25C 0.382775 no
7d_15C 7d_30C 0.192251 no
7d_15C 10d_25C 0.067447 no
7d_30C 10d_25C 0.719322 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g9029.t1
MNNLSSLCCRSSQGLRAVARPVRYASTSATPTSPKSPRSNSRRWLSIAFVGATAAGAGAYIQSQNTSSATLNPET
FTKYSIVSREPVSATSSLFTLRPRIPSDSNYDVYEEAWQTGVWSVMFKQPQLQIGRDYTPLPTTAATSLSVDDEN
EGCLRFFIRKDPFGEVSRYLHNIAVGADVEIRGPKIECAIPKETSDIVFIAGGTGIAPALQAAYSLLNRKNTEHR
PTIHILWANRIKDDCAGGHSDSLKPQSRRGWFSGWFGSKSRDNTSEKPVDVVRTEETSIIVRELEALKAQYPGQV
IVDYYLDEENTFIGKEDIRGAIAPASKGNSRRSNLILVSGPEGFISYMAGPKLWAQGQELQGPLKGIIKELDLKE
WAVWKL*
Coding >Pro_DTO377G3_2|g9029.t1
ATGAACAACCTATCTTCTTTATGCTGTAGAAGCAGCCAGGGTCTCAGAGCTGTAGCTCGGCCTGTACGCTATGCT
TCAACCTCAGCAACCCCGACGTCACCGAAGTCCCCCCGTTCCAACTCGCGCCGCTGGCTAAGCATCGCCTTCGTA
GGCGCAACAGCAGCAGGTGCAGGCGCCTATATCCAATCCCAAAATACATCATCCGCCACCTTGAACCCCGAAACA
TTCACCAAATACAGCATTGTATCCCGCGAGCCCGTGTCGGCAACCAGCAGCCTTTTCACGCTGCGGCCACGCATA
CCCAGCGACAGCAACTACGATGTCTACGAGGAAGCATGGCAGACGGGAGTCTGGAGTGTGATGTTCAAGCAACCA
CAATTACAAATCGGACGGGATTACACGCCGCTGCCCACGACGGCAGCGACATCGCTAAGTGTCGACGACGAGAAC
GAGGGCTGCCTGCGCTTCTTCATTCGAAAGGATCCCTTCGGAGAGGTCTCGCGCTACCTGCATAATATTGCTGTT
GGTGCTGACGTCGAGATTCGTGGACCCAAGATCGAATGCGCGATCCCGAAGGAAACGAGTGATATTGTCTTTATT
GCTGGTGGGACGGGGATTGCGCCAGCTCTGCAGGCTGCGTATTCTCTTTTGAATCGCAAAAATACTGAACATCGA
CCGACGATCCATATCTTGTGGGCGAATCGGATAAAGGATGACTGTGCTGGTGGTCATAGTGACTCGCTGAAGCCG
CAGTCACGCCGGGGCTGGTTCTCTGGGTGGTTTGGCTCGAAGAGTCGGGATAATACTTCGGAAAAGCCTGTGGAT
GTTGTACGAACAGAAGAAACTTCTATTATTGTGCGAGAGCTAGAGGCACTCAAGGCCCAGTATCCCGGGCAGGTT
ATTGTGGATTATTATCTGGACGAGGAGAACACGTTCATTGGGAAGGAAGATATCCGAGGTGCTATTGCACCAGCG
TCAAAAGGCAACTCTCGCAGGAGCAATTTGATTTTGGTTTCTGGTCCTGAGGGGTTCATCAGCTACATGGCTGGG
CCTAAGCTGTGGGCGCAAGGTCAGGAGCTCCAGGGCCCCCTAAAAGGAATCATCAAGGAGCTTGATCTCAAAGAA
TGGGCTGTGTGGAAGCTCTGA
Transcript >Pro_DTO377G3_2|g9029.t1
ATGAACAACCTATCTTCTTTATGCTGTAGAAGCAGCCAGGGTCTCAGAGCTGTAGCTCGGCCTGTACGCTATGCT
TCAACCTCAGCAACCCCGACGTCACCGAAGTCCCCCCGTTCCAACTCGCGCCGCTGGCTAAGCATCGCCTTCGTA
GGCGCAACAGCAGCAGGTGCAGGCGCCTATATCCAATCCCAAAATACATCATCCGCCACCTTGAACCCCGAAACA
TTCACCAAATACAGCATTGTATCCCGCGAGCCCGTGTCGGCAACCAGCAGCCTTTTCACGCTGCGGCCACGCATA
CCCAGCGACAGCAACTACGATGTCTACGAGGAAGCATGGCAGACGGGAGTCTGGAGTGTGATGTTCAAGCAACCA
CAATTACAAATCGGACGGGATTACACGCCGCTGCCCACGACGGCAGCGACATCGCTAAGTGTCGACGACGAGAAC
GAGGGCTGCCTGCGCTTCTTCATTCGAAAGGATCCCTTCGGAGAGGTCTCGCGCTACCTGCATAATATTGCTGTT
GGTGCTGACGTCGAGATTCGTGGACCCAAGATCGAATGCGCGATCCCGAAGGAAACGAGTGATATTGTCTTTATT
GCTGGTGGGACGGGGATTGCGCCAGCTCTGCAGGCTGCGTATTCTCTTTTGAATCGCAAAAATACTGAACATCGA
CCGACGATCCATATCTTGTGGGCGAATCGGATAAAGGATGACTGTGCTGGTGGTCATAGTGACTCGCTGAAGCCG
CAGTCACGCCGGGGCTGGTTCTCTGGGTGGTTTGGCTCGAAGAGTCGGGATAATACTTCGGAAAAGCCTGTGGAT
GTTGTACGAACAGAAGAAACTTCTATTATTGTGCGAGAGCTAGAGGCACTCAAGGCCCAGTATCCCGGGCAGGTT
ATTGTGGATTATTATCTGGACGAGGAGAACACGTTCATTGGGAAGGAAGATATCCGAGGTGCTATTGCACCAGCG
TCAAAAGGCAACTCTCGCAGGAGCAATTTGATTTTGGTTTCTGGTCCTGAGGGGTTCATCAGCTACATGGCTGGG
CCTAAGCTGTGGGCGCAAGGTCAGGAGCTCCAGGGCCCCCTAAAAGGAATCATCAAGGAGCTTGATCTCAAAGAA
TGGGCTGTGTGGAAGCTCTGA
Gene >Pro_DTO377G3_2|g9029.t1
ATGAACAACCTATCTTCTTTATGCTGTAGAAGCAGCCAGGGTCTCAGAGCTGTAGCTCGGCCTGTACGCTATGCT
TCAACCTCAGCAACCCCGACGTCACCGAAGTCCCCCCGTTCCAACTCGCGCCGCTGGCTAAGCATCGCCTTCGTA
GGCGCAACAGCAGCAGGTGCAGGCGCCTATATCCAATCCCAAAATACATCATCCGCCACCTTGAACCCCGAAACA
TTCACCAAATACAGCATTGTATCCCGCGAGCCCGTGTCGGCAACCAGCAGCCTTTTCACGCTGCGGCCACGCATA
CCCAGCGACAGCAACTACGATGTCTACGAGGAAGCATGGCAGACGGGAGTCTGGAGTGTGATGTTCAAGCAACCA
CAATTACAAATCGGACGGGATTACACGCCGCTGCCCACGACGGCAGCGACATCGCTAAGTGTCGACGACGAGAAC
GAGGGCTGCCTGCGCTTCTTCATTCGAAAGGATCCCTTCGGAGAGGTCTCGCGCTACCTGCATAATATTGCTGTT
GGTGCTGACGTCGAGATTCGTGGACCCAAGATCGAATGCGCGATCCCGAAGGAAACGAGTGATATTGTCTTTATT
GCTGGTGGGACGGGGATTGCGCCAGCTCTGCAGGCTGCGTATTCTCTTTTGAATCGCAAAAATACTGAACATCGA
CCGACGATCCATATCTTGTGGGCGAATCGGATAAAGGATGACTGTGCTGGTGGTCATAGTGACTCGCTGAAGCCG
CAGTCACGCCGGGGCTGGTTCTCTGGGTGGTTTGGCTCGAAGAGTCGGGATAATACTTCGGAAAAGCCTGTGGAT
GTTGTACGAACAGAAGAAACTTCTATTATTGTGCGAGAGCTAGAGGCACTCAAGGCCCAGTATCCCGGGCAGGTT
ATTGTGGATTATTATCTGGACGAGGAGAACACGTTCATTGGGAAGGAAGATATCCGAGGTGCTATTGCACCAGCG
TCAAAAGGCAACTCTCGCAGGAGCAATTTGATTTTGGTTTCTGGTCCTGAGGGGTTCATCAGCTACATGGCTGGG
CCTAAGCTGTGGGCGCAAGGTCAGGAGCTCCAGGGCCCCCTAAAAGGAATCATCAAGGAGCTTGATCTCAAAGAA
TGGGCTGTGTGGAAGCTCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail