Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g9028.t1
Gene name
Locationscaffold_40:108020..109898
Strand-
Gene length (bp)1878
Transcript length (bp)1830
Coding sequence length (bp)1830
Protein length (aa) 610

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13520 AA_permease_2 Amino acid permease 3.0E-58 125 582
PF00324 AA_permease Amino acid permease 4.5E-25 133 450

GO

GO Term Description Terminal node
GO:0055085 transmembrane transport Yes
GO:0022857 transmembrane transporter activity Yes
GO:0016020 membrane Yes
GO:0008150 biological_process No
GO:0051234 establishment of localization No
GO:0006810 transport No
GO:0005575 cellular_component No
GO:0051179 localization No
GO:0005215 transporter activity No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 35 0.45

Transmembrane Domains

Domain # Start End Length
1 124 146 22
2 161 183 22
3 204 226 22
4 246 265 19
5 277 299 22
6 314 336 22
7 359 381 22
8 401 423 22
9 484 506 22
10 511 533 22
11 546 568 22
12 573 592 19

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g9028.t1
MSNTYQGNRNGSLAAPRDSLELASLASSSPGSVGGSSRSSSPDGVSSSRKLSLEDEDPLAESHQDAELGRRHRAQ
SSFSISSAFDFGRNLFPLSQTQGGYAPLGTPSADRPGFTDGSLERNKTLTYLNGLSLIVGLIIGSGIFSSPSQVN
ANAGSPGASLIVWAVAGLLAWTGAASYAELGGAIPLNGGSQIYLSKIFGELTGFLFAWCAVLVLKPGSAAIISLI
FGEYVVRAFVGADVGDVNPWINKGVAFGGLVAVTLLNCISTKFATRIGDFFMFFKFVALLGVTVIGIIVAVTGFS
AGGNANEEWKTTGWFEGTTTEISDFAVALYAGLWAFDGWDNTNYVTGEFKNPNRDLPRVIHTAMPLVIISYLLAN
VSYFLVLPHSTIEASNTIAVQFGAKVFGAPGALILALVVSASCFGALNATTFTSGRLVYAAGKEGYLPSIFGRIG
LHASSQGPPASSRLRRRSWASRALSRFFGDNSRLGFTPIYAMAFNGVLTTIYIVVGEFGTLVTFYGVAGYTFYFL
TVLGLIVLRIREPLLERPYRTWITTPIIFCCVSLFLLSRAVISEPLQTLIVVAFIITGVPVYYWRIYKRDGRIDL
PSWKFWKRR*
Coding >Pro_DTO377G3_2|g9028.t1
ATGTCGAATACATATCAAGGGAACAGGAATGGTAGCCTCGCTGCGCCTCGAGACTCACTAGAACTCGCCTCCCTC
GCATCCTCATCTCCCGGCTCCGTAGGCGGGTCCTCACGCTCCTCTTCCCCCGACGGTGTCTCTTCATCCCGCAAG
CTCTCCCTTGAGGACGAAGATCCTCTCGCAGAATCGCATCAAGATGCCGAGCTAGGGCGCCGTCACAGAGCTCAG
AGCTCGTTCTCCATATCCTCAGCTTTTGATTTCGGGCGCAATCTATTCCCGCTGTCGCAAACACAGGGTGGTTAC
GCGCCCCTAGGTACTCCGTCCGCGGACAGACCAGGCTTCACAGACGGATCGCTGGAGCGGAATAAAACCTTGACA
TACCTGAACGGTCTATCGCTCATCGTTGGGCTGATTATTGGATCTGGTATCTTCTCGTCACCGAGTCAGGTCAAT
GCCAACGCGGGGTCGCCGGGCGCCTCGCTCATCGTTTGGGCTGTGGCTGGTCTGCTGGCCTGGACGGGCGCTGCT
AGCTATGCAGAGCTGGGAGGAGCAATTCCACTGAACGGAGGCTCGCAGATCTATCTGTCCAAGATCTTTGGAGAG
CTGACGGGTTTCCTTTTCGCATGGTGTGCCGTGTTAGTATTGAAACCTGGCTCTGCGGCGATTATCTCTCTCATC
TTTGGCGAATACGTTGTCCGTGCGTTTGTGGGCGCTGATGTTGGCGACGTAAATCCTTGGATCAACAAGGGTGTT
GCATTTGGAGGGCTTGTCGCAGTGACTCTGCTCAATTGCATCTCCACCAAGTTCGCTACCCGCATTGGTGATTTC
TTTATGTTCTTCAAGTTCGTTGCTCTGCTAGGTGTCACAGTCATCGGGATTATAGTCGCTGTAACTGGCTTCTCG
GCTGGAGGCAACGCAAATGAAGAATGGAAGACGACAGGATGGTTCGAGGGAACCACCACCGAGATATCTGATTTT
GCAGTGGCCCTGTATGCAGGTCTTTGGGCATTTGACGGCTGGGACAATACCAACTACGTGACGGGCGAATTCAAG
AACCCAAACCGCGATCTGCCCCGAGTCATCCACACGGCGATGCCACTGGTCATCATCTCCTATCTGCTCGCCAAT
GTCTCCTATTTCCTTGTTCTTCCTCACTCCACCATTGAGGCGAGCAACACCATCGCCGTCCAATTCGGCGCAAAG
GTATTCGGCGCCCCCGGAGCCTTGATTTTAGCTCTCGTCGTCTCAGCCAGCTGCTTCGGAGCTCTAAACGCAACC
ACCTTCACAAGTGGCCGACTAGTCTACGCAGCCGGCAAGGAAGGGTATCTCCCCTCAATATTCGGCCGGATCGGT
CTCCACGCCTCCTCGCAAGGCCCTCCAGCAAGCAGCCGACTACGCCGCCGCTCCTGGGCCAGCAGGGCCCTCTCC
CGTTTCTTCGGCGATAACTCCAGACTCGGCTTCACGCCAATATATGCCATGGCTTTTAACGGCGTCCTAACAACT
ATCTACATCGTCGTCGGCGAGTTCGGCACCCTCGTCACTTTCTATGGTGTAGCCGGATACACCTTCTACTTCCTC
ACCGTTCTCGGCCTGATCGTCCTCCGTATCCGTGAACCCCTGTTGGAACGTCCCTACCGCACCTGGATCACCACA
CCCATTATATTTTGCTGCGTGAGCCTTTTCCTCCTCAGCCGAGCTGTCATCTCCGAGCCCTTGCAAACGCTCATC
GTCGTCGCGTTCATCATCACCGGCGTGCCCGTCTACTACTGGCGTATTTATAAGCGAGATGGTCGAATCGATCTT
CCCAGCTGGAAATTCTGGAAGCGCCGATAA
Transcript >Pro_DTO377G3_2|g9028.t1
ATGTCGAATACATATCAAGGGAACAGGAATGGTAGCCTCGCTGCGCCTCGAGACTCACTAGAACTCGCCTCCCTC
GCATCCTCATCTCCCGGCTCCGTAGGCGGGTCCTCACGCTCCTCTTCCCCCGACGGTGTCTCTTCATCCCGCAAG
CTCTCCCTTGAGGACGAAGATCCTCTCGCAGAATCGCATCAAGATGCCGAGCTAGGGCGCCGTCACAGAGCTCAG
AGCTCGTTCTCCATATCCTCAGCTTTTGATTTCGGGCGCAATCTATTCCCGCTGTCGCAAACACAGGGTGGTTAC
GCGCCCCTAGGTACTCCGTCCGCGGACAGACCAGGCTTCACAGACGGATCGCTGGAGCGGAATAAAACCTTGACA
TACCTGAACGGTCTATCGCTCATCGTTGGGCTGATTATTGGATCTGGTATCTTCTCGTCACCGAGTCAGGTCAAT
GCCAACGCGGGGTCGCCGGGCGCCTCGCTCATCGTTTGGGCTGTGGCTGGTCTGCTGGCCTGGACGGGCGCTGCT
AGCTATGCAGAGCTGGGAGGAGCAATTCCACTGAACGGAGGCTCGCAGATCTATCTGTCCAAGATCTTTGGAGAG
CTGACGGGTTTCCTTTTCGCATGGTGTGCCGTGTTAGTATTGAAACCTGGCTCTGCGGCGATTATCTCTCTCATC
TTTGGCGAATACGTTGTCCGTGCGTTTGTGGGCGCTGATGTTGGCGACGTAAATCCTTGGATCAACAAGGGTGTT
GCATTTGGAGGGCTTGTCGCAGTGACTCTGCTCAATTGCATCTCCACCAAGTTCGCTACCCGCATTGGTGATTTC
TTTATGTTCTTCAAGTTCGTTGCTCTGCTAGGTGTCACAGTCATCGGGATTATAGTCGCTGTAACTGGCTTCTCG
GCTGGAGGCAACGCAAATGAAGAATGGAAGACGACAGGATGGTTCGAGGGAACCACCACCGAGATATCTGATTTT
GCAGTGGCCCTGTATGCAGGTCTTTGGGCATTTGACGGCTGGGACAATACCAACTACGTGACGGGCGAATTCAAG
AACCCAAACCGCGATCTGCCCCGAGTCATCCACACGGCGATGCCACTGGTCATCATCTCCTATCTGCTCGCCAAT
GTCTCCTATTTCCTTGTTCTTCCTCACTCCACCATTGAGGCGAGCAACACCATCGCCGTCCAATTCGGCGCAAAG
GTATTCGGCGCCCCCGGAGCCTTGATTTTAGCTCTCGTCGTCTCAGCCAGCTGCTTCGGAGCTCTAAACGCAACC
ACCTTCACAAGTGGCCGACTAGTCTACGCAGCCGGCAAGGAAGGGTATCTCCCCTCAATATTCGGCCGGATCGGT
CTCCACGCCTCCTCGCAAGGCCCTCCAGCAAGCAGCCGACTACGCCGCCGCTCCTGGGCCAGCAGGGCCCTCTCC
CGTTTCTTCGGCGATAACTCCAGACTCGGCTTCACGCCAATATATGCCATGGCTTTTAACGGCGTCCTAACAACT
ATCTACATCGTCGTCGGCGAGTTCGGCACCCTCGTCACTTTCTATGGTGTAGCCGGATACACCTTCTACTTCCTC
ACCGTTCTCGGCCTGATCGTCCTCCGTATCCGTGAACCCCTGTTGGAACGTCCCTACCGCACCTGGATCACCACA
CCCATTATATTTTGCTGCGTGAGCCTTTTCCTCCTCAGCCGAGCTGTCATCTCCGAGCCCTTGCAAACGCTCATC
GTCGTCGCGTTCATCATCACCGGCGTGCCCGTCTACTACTGGCGTATTTATAAGCGAGATGGTCGAATCGATCTT
CCCAGCTGGAAATTCTGGAAGCGCCGATAA
Gene >Pro_DTO377G3_2|g9028.t1
ATGTCGAATACATATCAAGGGAACAGGAATGGTAGCCTCGCTGCGCCTCGAGACTCACTAGAACTCGCCTCCCTC
GCATCCTCATCTCCCGGCTCCGTAGGCGGGTCCTCACGCTCCTCTTCCCCCGACGGTGTCTCTTCATCCCGCAAG
CTCTCCCTTGAGGACGAAGATCCTCTCGCAGAATCGCATCAAGATGCCGAGCTAGGGCGCCGTCACAGAGCTCAG
AGCTCGTTCTCCATATCCTCAGCTTTTGATTTCGGGCGCAATCTATTCCCGCTGTCGCAAACACAGGGTGGTTAC
GCGCCCCTAGGTACTCCGTCCGCGGACAGACCAGGCTTCACAGACGGATCGCTGGAGCGGAATAAAACCTTGACA
TACCTGAACGGTCTATCGCTCATCGTTGGGCTGATTATTGGATCTGGTATCTTCTCGTCACCGAGTCAGGTCAAT
GCCAACGCGGGGTCGCCGGGCGCCTCGCTCATCGTTTGGGCTGTGGCTGGTCTGCTGGCCTGGACGGGCGCTGCT
AGCTATGCAGAGCTGGGAGGAGCAATTCCACTGAACGGAGGCTCGCAGATCTATCTGTCCAAGATCTTTGGAGAG
CTGACGGGTTTCCTTTTCGCATGGTGTGCCGTGTTAGTATTGAAACCTGGCTCTGCGGCGATTATCTCTCTCATC
TTTGGCGAATACGTTGTCCGTGCGTTTGTGGGCGCTGATGTTGGCGACGTAAATCCTTGGATCAACAAGGGTGTT
GCATTTGGAGGGCTTGTCGCAGTGACTCTGCTCAATTGCATCTCCACCAAGTTCGCTACCCGCATTGGTGATTTC
TTTATGTTCTTCAAGTTCGTTGCTCTGCTAGGTGTCACAGTCATCGGGATTATAGTCGCTGTAACTGGCTTCTCG
GCTGGAGGCAACGCAAATGAAGAATGGAAGACGACAGGATGGTTCGAGGGAACCACCACCGAGATATCTGATTTT
GCAGTGGCCCTGTATGCAGGTCTTTGGGCATTTGACGGCTGGGACAATGTAAGTTGACACTCAAGTATTTTGAAT
GCTTCCACTCACATCTTACAGACCAACTACGTGACGGGCGAATTCAAGAACCCAAACCGCGATCTGCCCCGAGTC
ATCCACACGGCGATGCCACTGGTCATCATCTCCTATCTGCTCGCCAATGTCTCCTATTTCCTTGTTCTTCCTCAC
TCCACCATTGAGGCGAGCAACACCATCGCCGTCCAATTCGGCGCAAAGGTATTCGGCGCCCCCGGAGCCTTGATT
TTAGCTCTCGTCGTCTCAGCCAGCTGCTTCGGAGCTCTAAACGCAACCACCTTCACAAGTGGCCGACTAGTCTAC
GCAGCCGGCAAGGAAGGGTATCTCCCCTCAATATTCGGCCGGATCGGTCTCCACGCCTCCTCGCAAGGCCCTCCA
GCAAGCAGCCGACTACGCCGCCGCTCCTGGGCCAGCAGGGCCCTCTCCCGTTTCTTCGGCGATAACTCCAGACTC
GGCTTCACGCCAATATATGCCATGGCTTTTAACGGCGTCCTAACAACTATCTACATCGTCGTCGGCGAGTTCGGC
ACCCTCGTCACTTTCTATGGTGTAGCCGGATACACCTTCTACTTCCTCACCGTTCTCGGCCTGATCGTCCTCCGT
ATCCGTGAACCCCTGTTGGAACGTCCCTACCGCACCTGGATCACCACACCCATTATATTTTGCTGCGTGAGCCTT
TTCCTCCTCAGCCGAGCTGTCATCTCCGAGCCCTTGCAAACGCTCATCGTCGTCGCGTTCATCATCACCGGCGTG
CCCGTCTACTACTGGCGTATTTATAAGCGAGATGGTCGAATCGATCTTCCCAGCTGGAAATTCTGGAAGCGCCGA
TAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail