Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g8998.t1
Gene name
Locationscaffold_40:37154..40106
Strand+
Gene length (bp)2952
Transcript length (bp)2580
Coding sequence length (bp)2580
Protein length (aa) 860

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF19316 PIGO_PIGG GPI ethanolamine phosphate transferase membrane region 4.6E-154 433 851
PF01663 Phosphodiest Type I phosphodiesterase / nucleotide pyrophosphatase 2.1E-07 187 263

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 27 0.5

Transmembrane Domains

Domain # Start End Length
1 7 29 22
2 438 460 22
3 467 489 22
4 573 590 17
5 597 619 22
6 644 666 22
7 712 734 22
8 754 776 22
9 796 818 22
10 828 850 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 19.33 11.08 27.57
5d_25C Five days - 25 degrees Celsius 24.43 14.44 34.43
7d_25C Seven days - 25 degrees Celsius 25.13 14.95 35.32
10d_25C Ten days - 25 degrees Celsius 31.32 18.92 43.72
7d_15C Seven days - 15 degrees Celsius 21.27 12.41 30.12
7d_30C Seven days - 30 degrees Celsius 24.49 14.49 34.49

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.370874 no
3d_25C 7d_25C 0.292891 no
3d_25C 7d_15C 0.765441 no
3d_25C 7d_30C 0.364628 no
3d_25C 10d_25C 0.026091 yes
5d_25C 7d_25C 0.936115 no
5d_25C 7d_15C 0.634732 no
5d_25C 7d_30C 0.995129 no
5d_25C 10d_25C 0.302605 no
7d_25C 7d_15C 0.540332 no
7d_25C 7d_30C 0.940247 no
7d_25C 10d_25C 0.366914 no
7d_15C 7d_30C 0.626341 no
7d_15C 10d_25C 0.082934 no
7d_30C 10d_25C 0.307873 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g8998.t1
MAGFRSWTTVIANLLVPVGILTFSSGFFPYKPLIPGLATFDETGQNVIVPAAFDKVIFMVVDALRSDFVYSNESG
FLFTQSLIRSGAALPFTAYASAPTVTMPRLKAITTGSVPSFLDVILNIAESDTSSTLAYQDTWLAQLKATGGRLV
MYGDDTWLKLFPGMFDRADGTTSFFVSDFTEVDHNVTRHVPHELAQDDWSALIMHYLGLDHIGHKAGPKSPFMIP
KQHEMDSVVTEIYTAMQQQDHLQSTLFVLCGDHGMNEAGNHGGSSAGETSPALLFISPKFEALGGRRESPVEPSG
DMQYYQTVEQADIAPTLAGLLGIPIPLNSLGVFIPEFLEMWDHGSHKLRILYQNAEQLLNTLTTTFPGSTFGPDS
PTSCAPGLPSGIEGAQCAWARVQQLLSGRDEADDSYSTAGPDLLQFLRIAQEVMSRTASNYDVSRLILGLLITGI
AGLLVLPATYKECTRHGSSGMFLTLMIITCGMMMFASSYVEEEQQFWYWICSGWIVYLHMKSQSSAKPLSHKRSG
LLLYWSDKCIILVLAITQRLLRRWNQTGQKFAAEPDIARTFFARHPEIFWGLFILAYVDAGRHLLGSIPIPGLLR
LGVLAPSALAFTFKLHFVTSESPELLDGTFISQIMKEWPYSLSLVLHARLVFYGLAVVVLLSLFAGKRSRVPRVP
YDTIHEALHIFLMTQSRATNVPLFLIFRIQAGILSSMNLTGIEVTITTLIFQYMTFFAFGGSNAISSVDLASGYN
GVDSYSVVLVGVLTFASNWAGPIWWASQSHRLRPKSPVGQDPSALLTFHVAVSLVSVMAACTALRTHLFIWTVFS
PKYLYSMAWATANHVGVNLLGEVIFSRSRSRHSS*
Coding >Pro_DTO377G3_2|g8998.t1
ATGGCGGGCTTCCGCAGTTGGACGACAGTCATTGCCAATTTGCTGGTGCCCGTGGGCATACTCACCTTCTCTTCA
GGGTTCTTCCCTTATAAACCGTTGATCCCTGGATTAGCGACTTTTGATGAAACCGGCCAGAATGTCATAGTGCCT
GCGGCTTTTGATAAAGTTATCTTCATGGTTGTTGATGCGCTGAGGAGCGACTTTGTATATTCGAACGAGTCGGGT
TTCTTGTTTACACAGAGCTTGATCCGGTCCGGTGCTGCATTGCCATTCACTGCCTATGCAAGCGCTCCAACTGTC
ACAATGCCTCGATTAAAAGCTATCACAACTGGTTCAGTTCCATCTTTTCTAGATGTTATTCTCAATATCGCAGAA
TCGGATACCTCGTCAACACTGGCATACCAGGACACCTGGTTGGCACAATTGAAGGCTACAGGAGGACGGCTTGTG
ATGTATGGGGATGATACCTGGCTCAAGCTCTTCCCGGGAATGTTTGACCGAGCTGATGGAACTACAAGCTTCTTC
GTGTCGGACTTCACGGAAGTAGACCATAATGTGACTCGACACGTTCCTCACGAGCTTGCCCAGGATGACTGGTCT
GCTCTGATAATGCATTACCTAGGTCTCGATCACATAGGACATAAGGCTGGCCCCAAAAGTCCATTCATGATACCG
AAACAGCACGAGATGGACTCTGTGGTGACTGAAATCTATACCGCAATGCAGCAACAAGATCATCTTCAATCCACA
CTTTTCGTGTTGTGCGGAGATCATGGCATGAACGAGGCTGGAAACCATGGCGGGTCATCTGCTGGAGAAACATCC
CCCGCGTTACTTTTCATTTCACCCAAGTTTGAAGCCTTGGGTGGCCGAAGAGAAAGCCCAGTGGAACCGTCGGGT
GATATGCAGTACTACCAAACGGTTGAGCAGGCGGACATTGCTCCGACCTTGGCGGGGCTTCTTGGTATCCCAATT
CCTTTAAACAGTCTTGGGGTATTCATCCCAGAATTTTTAGAGATGTGGGATCATGGTTCTCATAAACTTCGAATC
TTATATCAAAATGCTGAGCAGCTGCTGAACACGTTGACAACAACATTCCCTGGATCTACGTTTGGCCCCGATAGT
CCTACATCCTGTGCTCCAGGACTTCCATCAGGTATTGAGGGAGCTCAATGTGCGTGGGCTCGAGTCCAGCAACTT
CTCTCAGGTAGGGATGAAGCAGATGATTCTTACTCTACAGCTGGCCCCGATTTGCTGCAATTTTTAAGGATTGCA
CAGGAAGTTATGAGTCGTACTGCCAGTAACTACGATGTCTCCAGACTCATTCTGGGCTTGTTGATCACGGGGATT
GCAGGCCTGCTTGTCCTTCCGGCCACATACAAGGAATGCACACGTCACGGATCTTCCGGGATGTTTTTGACGCTT
ATGATCATCACCTGTGGGATGATGATGTTTGCTAGTAGCTATGTGGAAGAAGAGCAGCAGTTCTGGTATTGGATC
TGCTCGGGGTGGATTGTCTACCTGCACATGAAATCGCAATCGTCTGCAAAGCCGCTCTCACACAAACGCTCTGGA
TTATTATTATATTGGTCTGACAAATGTATCATTCTTGTGCTCGCCATCACCCAGCGGCTCTTGCGACGATGGAAC
CAAACTGGTCAGAAATTCGCGGCCGAGCCTGATATTGCTCGCACATTCTTTGCACGCCACCCGGAAATCTTCTGG
GGTCTTTTTATCCTCGCGTACGTGGATGCCGGTCGTCATCTTCTCGGGAGTATACCAATCCCTGGATTATTGAGG
CTAGGTGTCTTGGCCCCCTCCGCGTTGGCCTTTACGTTCAAATTGCACTTTGTGACTTCGGAATCGCCCGAACTC
CTTGATGGGACATTCATCTCGCAAATCATGAAGGAATGGCCCTACAGTCTATCATTGGTCTTGCATGCCAGGCTC
GTGTTTTACGGACTTGCTGTCGTTGTCCTACTATCGCTCTTTGCCGGAAAACGATCAAGAGTCCCCCGAGTACCA
TATGATACAATCCATGAAGCTCTGCACATCTTCCTAATGACGCAGTCCCGTGCCACTAACGTCCCCCTGTTCCTA
ATTTTCCGAATCCAGGCCGGCATTCTCTCTTCCATGAACCTCACAGGGATTGAGGTGACAATCACAACCTTGATC
TTCCAATATATGACGTTCTTCGCGTTTGGCGGATCCAATGCAATCTCCTCTGTAGACCTTGCTAGTGGATATAAC
GGTGTTGACAGCTACAGCGTGGTGTTGGTGGGAGTTCTCACCTTTGCGAGCAACTGGGCAGGGCCTATCTGGTGG
GCATCACAAAGCCATCGTCTCCGGCCGAAGAGTCCCGTAGGACAAGACCCCTCGGCACTGTTGACATTCCATGTT
GCCGTGTCCTTGGTTTCTGTCATGGCCGCCTGTACAGCCCTCCGGACGCATCTTTTCATCTGGACCGTTTTCTCG
CCCAAGTATCTCTACAGTATGGCGTGGGCCACTGCCAATCATGTTGGTGTCAATTTATTGGGCGAGGTTATTTTC
TCTCGATCGCGATCTCGTCATTCTTCATAA
Transcript >Pro_DTO377G3_2|g8998.t1
ATGGCGGGCTTCCGCAGTTGGACGACAGTCATTGCCAATTTGCTGGTGCCCGTGGGCATACTCACCTTCTCTTCA
GGGTTCTTCCCTTATAAACCGTTGATCCCTGGATTAGCGACTTTTGATGAAACCGGCCAGAATGTCATAGTGCCT
GCGGCTTTTGATAAAGTTATCTTCATGGTTGTTGATGCGCTGAGGAGCGACTTTGTATATTCGAACGAGTCGGGT
TTCTTGTTTACACAGAGCTTGATCCGGTCCGGTGCTGCATTGCCATTCACTGCCTATGCAAGCGCTCCAACTGTC
ACAATGCCTCGATTAAAAGCTATCACAACTGGTTCAGTTCCATCTTTTCTAGATGTTATTCTCAATATCGCAGAA
TCGGATACCTCGTCAACACTGGCATACCAGGACACCTGGTTGGCACAATTGAAGGCTACAGGAGGACGGCTTGTG
ATGTATGGGGATGATACCTGGCTCAAGCTCTTCCCGGGAATGTTTGACCGAGCTGATGGAACTACAAGCTTCTTC
GTGTCGGACTTCACGGAAGTAGACCATAATGTGACTCGACACGTTCCTCACGAGCTTGCCCAGGATGACTGGTCT
GCTCTGATAATGCATTACCTAGGTCTCGATCACATAGGACATAAGGCTGGCCCCAAAAGTCCATTCATGATACCG
AAACAGCACGAGATGGACTCTGTGGTGACTGAAATCTATACCGCAATGCAGCAACAAGATCATCTTCAATCCACA
CTTTTCGTGTTGTGCGGAGATCATGGCATGAACGAGGCTGGAAACCATGGCGGGTCATCTGCTGGAGAAACATCC
CCCGCGTTACTTTTCATTTCACCCAAGTTTGAAGCCTTGGGTGGCCGAAGAGAAAGCCCAGTGGAACCGTCGGGT
GATATGCAGTACTACCAAACGGTTGAGCAGGCGGACATTGCTCCGACCTTGGCGGGGCTTCTTGGTATCCCAATT
CCTTTAAACAGTCTTGGGGTATTCATCCCAGAATTTTTAGAGATGTGGGATCATGGTTCTCATAAACTTCGAATC
TTATATCAAAATGCTGAGCAGCTGCTGAACACGTTGACAACAACATTCCCTGGATCTACGTTTGGCCCCGATAGT
CCTACATCCTGTGCTCCAGGACTTCCATCAGGTATTGAGGGAGCTCAATGTGCGTGGGCTCGAGTCCAGCAACTT
CTCTCAGGTAGGGATGAAGCAGATGATTCTTACTCTACAGCTGGCCCCGATTTGCTGCAATTTTTAAGGATTGCA
CAGGAAGTTATGAGTCGTACTGCCAGTAACTACGATGTCTCCAGACTCATTCTGGGCTTGTTGATCACGGGGATT
GCAGGCCTGCTTGTCCTTCCGGCCACATACAAGGAATGCACACGTCACGGATCTTCCGGGATGTTTTTGACGCTT
ATGATCATCACCTGTGGGATGATGATGTTTGCTAGTAGCTATGTGGAAGAAGAGCAGCAGTTCTGGTATTGGATC
TGCTCGGGGTGGATTGTCTACCTGCACATGAAATCGCAATCGTCTGCAAAGCCGCTCTCACACAAACGCTCTGGA
TTATTATTATATTGGTCTGACAAATGTATCATTCTTGTGCTCGCCATCACCCAGCGGCTCTTGCGACGATGGAAC
CAAACTGGTCAGAAATTCGCGGCCGAGCCTGATATTGCTCGCACATTCTTTGCACGCCACCCGGAAATCTTCTGG
GGTCTTTTTATCCTCGCGTACGTGGATGCCGGTCGTCATCTTCTCGGGAGTATACCAATCCCTGGATTATTGAGG
CTAGGTGTCTTGGCCCCCTCCGCGTTGGCCTTTACGTTCAAATTGCACTTTGTGACTTCGGAATCGCCCGAACTC
CTTGATGGGACATTCATCTCGCAAATCATGAAGGAATGGCCCTACAGTCTATCATTGGTCTTGCATGCCAGGCTC
GTGTTTTACGGACTTGCTGTCGTTGTCCTACTATCGCTCTTTGCCGGAAAACGATCAAGAGTCCCCCGAGTACCA
TATGATACAATCCATGAAGCTCTGCACATCTTCCTAATGACGCAGTCCCGTGCCACTAACGTCCCCCTGTTCCTA
ATTTTCCGAATCCAGGCCGGCATTCTCTCTTCCATGAACCTCACAGGGATTGAGGTGACAATCACAACCTTGATC
TTCCAATATATGACGTTCTTCGCGTTTGGCGGATCCAATGCAATCTCCTCTGTAGACCTTGCTAGTGGATATAAC
GGTGTTGACAGCTACAGCGTGGTGTTGGTGGGAGTTCTCACCTTTGCGAGCAACTGGGCAGGGCCTATCTGGTGG
GCATCACAAAGCCATCGTCTCCGGCCGAAGAGTCCCGTAGGACAAGACCCCTCGGCACTGTTGACATTCCATGTT
GCCGTGTCCTTGGTTTCTGTCATGGCCGCCTGTACAGCCCTCCGGACGCATCTTTTCATCTGGACCGTTTTCTCG
CCCAAGTATCTCTACAGTATGGCGTGGGCCACTGCCAATCATGTTGGTGTCAATTTATTGGGCGAGGTTATTTTC
TCTCGATCGCGATCTCGTCATTCTTCATAA
Gene >Pro_DTO377G3_2|g8998.t1
ATGGCGGGCTTCCGCAGTTGGACGACAGTCATTGCCAATTTGCTGGTGCCCGTGGGCATACTCACCTTCTCTTCA
GGGTTCTTCCCTTATAAACCGTTGATCCCTGGATTAGCGACTTTTGATGAAACCGGCCAGAATGTCATAGTGCCT
GCGGCTTTTGATAAAGTTATCTTCATGGTTGTTGATGCGCTGAGGAGGTATGATTTGAATAATTCAACTCCGAGC
TATATCAGTAACTAACAAGGTGCTCACATATAGCGACTTTGTATATTCGAACGAGTCGGGTTTCTTGTTTACACA
GAGGTGGGTGTCGCTTTTGAAATACACCATTTATTCGTTCGAAACAAGTGACTGATTGGATACTAGCTTGATCCG
GTCCGGTGCTGCATTGCCATTCACTGCCTATGCAAGCGCTCCAACTGTCACAATGCCTCGATTAAAAGCTATCAC
AACTGGTTCAGTTCCATCTTTTCTAGATGTTATTCTCAATATCGCAGAATCGGATACCTCGTCAACACTGGCATA
CCAGGACACCTGGTTGGCACAATTGAAGGCTACAGGAGGACGGCTTGTGATGTATGGGGATGATACCTGGCTCAA
GCTCTTCCCGGGAATGTTTGACCGAGCTGATGGAACTACAAGCTTCTTCGTGTCGGTCAGTTGTACTTTAGGTGT
TTGTGTATCCGCAGTATTAGTATTGAAACTGAGATTCTCCTCGCAGGACTTCACGGAAGTAGACCATAATGTGAC
TCGACACGTTCCTCACGAGCTTGCCCAGGATGACTGGTCTGCTCTGATAATGCATTACCTAGGTCTCGATCACAT
AGGACATAAGGCTGGCCCCAAAAGGTAAATTCAGCTCCCGATTTCATTATTAGCTGCTCTCTATCCTCTAACTCT
CCTAGTCCATTCATGATACCGAAACAGCACGAGATGGACTCTGTGGTGACTGAAATCTATACCGCAATGCAGCAA
CAAGATCATCTTCAATCCACACTTTTCGTGTTGTGCGGAGATCATGGCATGAACGAGGCTGGAAACCATGGCGGG
TCATCTGCTGGAGAAACATCCCCCGCGTTACTTTTCATTTCACCCAAGTTTGAAGCCTTGGGTGGCCGAAGAGAA
AGCCCAGTGGAACCGTCGGGTGATATGCAGTACTACCAAACGGTTGAGCAGGCGGACATTGCTCCGACCTTGGCG
GGGCTTCTTGGTATCCCAATTCCTTTAAACAGTCTTGGGGTATTCATCCCAGAATTTTTAGAGATGTGGGATCAT
GGTATGTAATCTATTCCTAATGGCGTCCAAGCGAAGAAAGATCCGGAACTGACTCGGGAACAGGTTCTCATAAAC
TTCGAATCTTATATCAAAATGCTGAGCAGCTGCTGAACACGTTGACAACAACATTCCCTGGATCTACGTTTGGCC
CCGATAGTCCTACATCCTGTGCTCCAGGACTTCCATCAGGTATTGAGGGAGCTCAATGTGCGTGGGCTCGAGTCC
AGCAACTTCTCTCAGGTAGGGATGAAGCAGATGATTCTTACTCTACAGCTGGCCCCGATTTGCTGCAATTTTTAA
GGATTGCACAGGAAGTTATGAGTCGTACTGCCAGTAACTACGATGTCTCCAGACTCATTCTGGGCTTGTTGATCA
CGGGGATTGCAGGCCTGCTTGTCCTTCCGGCCACATACAAGGAATGCACACGTCACGGATCTTCCGGGATGTTTT
TGACGCTTATGATCATCACCTGTGGGATGATGATGTTTGCTAGTAGCTATGTGGAAGAAGAGCAGCAGTTCTGGT
ATTGGATCTGCTCGGGGTGGATTGTCTACCTGCACATGAAATCGCAATCGTCTGCAAAGCCGCTCTCACACAAAC
GCTCTGGATTATTATTATATTGGTCTGACAAATGTATCATTCTTGTGCTCGCCATCACCCAGCGGCTCTTGCGAC
GATGGAACCAAACTGGTCAGAAATTCGCGGCCGAGCCTGATATTGCTCGCACATTCTTTGCACGCCACCCGGAAA
TCTTCTGGGGTCTTTTTATCCTCGCGTACGTGGATGCCGGTCGTCATCTTCTCGGGAGTATACCAATCCCTGGAT
TATTGAGGCTAGGTGTCTTGGCCCCCTCCGCGTTGGCCTTTACGTTCAAATTGCACTTTGTGACTTCGGAATCGC
CCGAACTCCTTGATGGGACATTCATCTCGCAAATCATGAAGGAATGGCCCTACAGTCTATCATTGGTCTTGCATG
CCAGGCTCGTGTTTTACGGACTTGCTGTCGTTGTCCTACTATCGCTCTTTGCCGGAAAACGATCAAGAGTCCCCC
GAGGTAAGCCCACACATGCGCTAGATTGCCTCTGAGCTTGGAGGTCATTACTGACCAGACTCTGTAGTACCATAT
GATACAATCCATGAAGCTCTGCACATCTTCCTAATGACGCAGTCCCGTGCCACTAACGTCCCCCTGTTCCTAATT
TTCCGAATCCAGGCCGGCATTCTCTCTTCCATGAACCTCACAGGGATTGAGGTGACAATCACAACCTTGATCTTC
CAATATATGACGTTCTTCGCGTTTGGCGGATCCAATGCAATCTCCTCTGTAGACCTTGCTAGTGGATATAACGGT
GTTGACAGCTACAGCGTGGTGTTGGTGGGAGTTCTCACCTTTGCGAGCAACTGGGCAGGGCCTATCTGGTGGGCA
TCACAAAGCCATCGTCTCCGGCCGAAGAGTCCCGTAGGACAAGACCCCTCGGCACTGTTGACATTCCATGTTGCC
GTGTCCTTGGTTTCTGTCATGGCCGCCTGTACAGCCCTCCGGACGCATCTTTTCATCTGGACCGTTTTCTCGCCC
AAGTATCTCTACAGTATGGCGTGGGCCACTGCCAATCATGTTGGTGTCAATTTATTGGGCGAGGTTATTTTCTCT
CGATCGCGATCTCGTCATTCTTCATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail