Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g8996.t1
Gene name
Locationscaffold_40:33841..35757
Strand-
Gene length (bp)1916
Transcript length (bp)1575
Coding sequence length (bp)1575
Protein length (aa) 525

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF14324 PINIT PINIT domain 1.5E-40 135 271
PF02891 zf-MIZ MIZ/SP-RING zinc finger 6.4E-22 313 361
PF11789 zf-Nse Zinc-finger of the MIZ type in Nse subunit 1.2E-06 305 360

GO

GO Term Description Terminal node
GO:0008270 zinc ion binding Yes
GO:0046914 transition metal ion binding No
GO:0005488 binding No
GO:0043167 ion binding No
GO:0046872 metal ion binding No
GO:0043169 cation binding No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
Zinc finger, MIZ-type

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g8996.t1
MSTSLSSEVATLTAFIKPLTNPQLKDLLRYEGLQVSGLKATLQFRIIQRIQSLAESDPVSFDALARRIRATAFPN
TVPYQSPARPQYQPPPVSQSPAQARSAPLGVSMSPHSYSGPSAPLMKPPAAAHKSPGPLIFKESPFYTILEPLTA
VVECKVREQTRDSVELKVMLSQQVAYRLQTDSNLRVMVYCAGDSGLTQYTKSDIAFPHQVELKVNLDEVKANLRG
LKNRPGTTQPADVTNWIRKKPNYPNNIVMTYALTQKKFFALANLVKQHPTDDLVSQLKTRKLISKEQVLREMRNR
ANDSDIVATSSVMSLKCPLSTLRIQVPCRSIVCTHNQCFDASSFLELQKQAPTWTCPVCSKSTSFESLQVDQYVD
DILQSTSPDTDQVIVEPDGVWSSPTDSDATKLGGMTPASDDDDDLIEISEPGMPVVKQEPGPTTVALERTPAQSQ
SREASTPSSAMRMSSKKRPIAQVIDLTESGDEDDESPLPPPKRPATSLPSRAFSRQDYHVPPASSPLNGGSYPP*
Coding >Pro_DTO377G3_2|g8996.t1
ATGTCGACCAGCCTGTCGTCAGAGGTCGCGACACTGACAGCCTTTATCAAGCCCCTTACAAATCCACAACTGAAA
GATTTGTTGAGGTATGAGGGCCTCCAGGTATCCGGGTTGAAGGCAACCCTACAGTTTCGCATTATCCAACGAATC
CAATCTCTCGCAGAATCTGACCCTGTCAGTTTCGATGCTCTAGCTCGGCGCATCCGTGCTACTGCTTTTCCAAAC
ACCGTGCCGTATCAATCACCCGCTAGACCACAATACCAGCCACCGCCTGTCTCTCAATCTCCTGCACAGGCTCGA
TCCGCGCCGCTCGGGGTTTCCATGTCACCTCACTCATACTCTGGTCCGAGTGCTCCTCTCATGAAACCTCCTGCG
GCCGCTCATAAATCTCCAGGTCCTTTGATTTTCAAAGAAAGTCCATTTTATACAATCCTAGAGCCTTTGACTGCA
GTCGTGGAATGTAAAGTACGCGAACAAACGCGGGATAGTGTTGAACTGAAGGTCATGCTATCTCAGCAAGTTGCC
TATAGGCTGCAAACGGACTCAAATCTTCGAGTGATGGTTTATTGCGCCGGTGATTCAGGTCTCACACAATACACC
AAGTCGGATATCGCATTTCCACATCAAGTGGAGCTCAAAGTCAATCTCGATGAAGTCAAAGCTAATCTCAGAGGC
CTGAAAAATAGGCCGGGCACCACACAACCTGCAGATGTGACCAACTGGATCCGTAAAAAGCCAAATTATCCTAAT
AATATTGTCATGACTTACGCATTGACGCAAAAGAAATTCTTCGCGCTTGCCAACCTCGTGAAGCAGCATCCGACT
GATGATCTTGTCTCGCAGTTGAAGACACGGAAACTCATCTCGAAGGAGCAAGTCTTGCGCGAAATGCGAAATCGC
GCAAATGACTCGGACATTGTCGCGACATCAAGTGTCATGTCACTTAAATGCCCTTTATCTACCCTCCGCATCCAA
GTACCCTGCCGCTCCATTGTTTGCACACACAACCAATGCTTTGATGCGTCTTCATTCCTTGAATTGCAAAAACAA
GCACCAACTTGGACCTGCCCTGTGTGTTCCAAATCAACTAGCTTTGAGTCTCTCCAAGTTGACCAGTACGTTGAT
GACATCCTTCAGTCAACGTCACCAGATACCGACCAAGTCATCGTTGAACCCGACGGCGTATGGTCAAGCCCCACT
GATTCCGACGCGACGAAATTGGGAGGGATGACTCCCGCGTCAGATGACGATGACGACTTGATCGAGATCAGCGAA
CCAGGGATGCCCGTTGTAAAACAGGAACCGGGACCCACGACCGTCGCCCTGGAACGAACACCTGCACAGTCACAG
TCACGAGAGGCATCCACCCCGTCCTCCGCGATGCGCATGTCCAGCAAAAAACGACCTATTGCTCAGGTCATCGAC
CTTACTGAAAGTGGTGATGAAGATGACGAGTCCCCTCTTCCACCTCCTAAAAGGCCAGCTACAAGTCTGCCATCC
CGGGCTTTTTCTCGTCAGGATTACCATGTCCCGCCCGCCAGCAGCCCTCTGAATGGCGGGTCGTACCCACCATGA
Transcript >Pro_DTO377G3_2|g8996.t1
ATGTCGACCAGCCTGTCGTCAGAGGTCGCGACACTGACAGCCTTTATCAAGCCCCTTACAAATCCACAACTGAAA
GATTTGTTGAGGTATGAGGGCCTCCAGGTATCCGGGTTGAAGGCAACCCTACAGTTTCGCATTATCCAACGAATC
CAATCTCTCGCAGAATCTGACCCTGTCAGTTTCGATGCTCTAGCTCGGCGCATCCGTGCTACTGCTTTTCCAAAC
ACCGTGCCGTATCAATCACCCGCTAGACCACAATACCAGCCACCGCCTGTCTCTCAATCTCCTGCACAGGCTCGA
TCCGCGCCGCTCGGGGTTTCCATGTCACCTCACTCATACTCTGGTCCGAGTGCTCCTCTCATGAAACCTCCTGCG
GCCGCTCATAAATCTCCAGGTCCTTTGATTTTCAAAGAAAGTCCATTTTATACAATCCTAGAGCCTTTGACTGCA
GTCGTGGAATGTAAAGTACGCGAACAAACGCGGGATAGTGTTGAACTGAAGGTCATGCTATCTCAGCAAGTTGCC
TATAGGCTGCAAACGGACTCAAATCTTCGAGTGATGGTTTATTGCGCCGGTGATTCAGGTCTCACACAATACACC
AAGTCGGATATCGCATTTCCACATCAAGTGGAGCTCAAAGTCAATCTCGATGAAGTCAAAGCTAATCTCAGAGGC
CTGAAAAATAGGCCGGGCACCACACAACCTGCAGATGTGACCAACTGGATCCGTAAAAAGCCAAATTATCCTAAT
AATATTGTCATGACTTACGCATTGACGCAAAAGAAATTCTTCGCGCTTGCCAACCTCGTGAAGCAGCATCCGACT
GATGATCTTGTCTCGCAGTTGAAGACACGGAAACTCATCTCGAAGGAGCAAGTCTTGCGCGAAATGCGAAATCGC
GCAAATGACTCGGACATTGTCGCGACATCAAGTGTCATGTCACTTAAATGCCCTTTATCTACCCTCCGCATCCAA
GTACCCTGCCGCTCCATTGTTTGCACACACAACCAATGCTTTGATGCGTCTTCATTCCTTGAATTGCAAAAACAA
GCACCAACTTGGACCTGCCCTGTGTGTTCCAAATCAACTAGCTTTGAGTCTCTCCAAGTTGACCAGTACGTTGAT
GACATCCTTCAGTCAACGTCACCAGATACCGACCAAGTCATCGTTGAACCCGACGGCGTATGGTCAAGCCCCACT
GATTCCGACGCGACGAAATTGGGAGGGATGACTCCCGCGTCAGATGACGATGACGACTTGATCGAGATCAGCGAA
CCAGGGATGCCCGTTGTAAAACAGGAACCGGGACCCACGACCGTCGCCCTGGAACGAACACCTGCACAGTCACAG
TCACGAGAGGCATCCACCCCGTCCTCCGCGATGCGCATGTCCAGCAAAAAACGACCTATTGCTCAGGTCATCGAC
CTTACTGAAAGTGGTGATGAAGATGACGAGTCCCCTCTTCCACCTCCTAAAAGGCCAGCTACAAGTCTGCCATCC
CGGGCTTTTTCTCGTCAGGATTACCATGTCCCGCCCGCCAGCAGCCCTCTGAATGGCGGGTCGTACCCACCATGA
Gene >Pro_DTO377G3_2|g8996.t1
ATGTCGACCAGCCTGTCGTCAGAGGTCGCGACACTGACAGCCTTTATCAAGCCCCTTACAAATCCACAACTGAAA
GATTTGTTGAGGTATGAGGGCCTCCAGGTATCCGGGTTGAAGGCAACCCTACAGTTTCGCATTATCCAACGTTCG
TCAACTCTCCCTAACTCTTATTATGACTTGTTCATTTGATCTTCAAATCTCTGCTTCACATCCCATTCTTGCAGC
GATCCGTACATTGACCGACGAAATAGGAATCCAATCTCTCGCAGAATCTGACCCTGTCAGTTTCGATGCTCTAGC
TCGGCGCATCCGTGCTACTGCTTTTCCAAACACCGTGCCGTATCAATCACCCGCTAGACCACAATACCAGCCACC
GCCTGTCTCTCAATCTCCTGCACAGGCTCGATCCGCGCCGCTCGGGGTTTCCATGTCACCTCACTCATACTCTGG
TCCGAGTGCTCCTCTCATGAAACCTCCTGCGGCCGCTCATAAATCTCCAGGTCCTTTGATTTTCAAAGAAAGTCC
ATTTTATACAATCCTAGAGCCTTTGACTGCAGTCGTGGAATGTAAAGGTATGTCACTATCTATCTGTGAAGCTTG
TTGAGGGTCTATGTCTAATTTTACCTAGTACGCGAACAAACGCGGGATAGTGTTGAACTGAAGGTCATGCTATCT
CAGCAAGTTGCCTATAGGCTGCAAACGGACTCAAATCTTCGAGTGATGGTTTATTGCGCCGGTGATTCAGGTCTC
ACACAATACACCAAGTCGGATATCGCATTTCCACATCAAGTGGAGCTCAAAGTCAATCTCGATGAAGTCAAAGCT
AATCTCAGAGGCCTGAAAAATAGGCCGGGCACCACACAACCTGCAGATGTGACCAACTGGATCCGTAAAAAGCCA
AATTATCCTAATAATATTGTCATGACTTACGCATTGACGCAAAAGGTTGAGCTTGTTCCCTTTATACTCGATAGA
GCATCTGTTAGGCCGGTTGACTAACTCCTGTTTGCACAGAAATTCTTCGCGCTTGCCAACCTCGTGAAGCAGCAT
CCGACTGATGATCTTGTCTCGCAGTTGAAGACACGGAAACTCATCTCGAAGGAGCAAGTCTTGCGCGAAAGTAAG
ATCCCCTCCTATTCCCTTGGGTCAGACTATGCTAATTTCGATCCTCAGTGCGAAATCGCGCAAATGACTCGGACA
TTGTCGCGACATCAAGTGTCATGTCACTTAAATGCCCTTTATCTACCCTCCGCATCCAAGTACCCTGCCGCTCCA
TTGTTTGCACACACAACCAATGCTTTGATGCGTCTTCATTCCTTGAATTGCAAAAACAAGCACCAACTTGGACCT
GCCCTGTGTGTTCCAAATCAACTAGCTTTGAGTCTCTCCAAGTTGACCAGTAAGTCTAAACCCCCTTCCTCGGCA
TATCTGTTTCTTTTCCTAACTGGTCGTATAGGTACGTTGATGACATCCTTCAGTCAACGTCACCAGATACCGACC
AAGTCATCGTTGAACCCGACGGCGTATGGTCAAGCCCCACTGATTCCGACGCGACGAAATTGGGAGGGATGACTC
CCGCGTCAGATGACGATGACGACTTGATCGAGATCAGCGAACCAGGGATGCCCGTTGTAAAACAGGAACCGGGAC
CCACGACCGTCGCCCTGGAACGAACACCTGCACAGTCACAGTCACGAGAGGCATCCACCCCGTCCTCCGCGATGC
GCATGTCCAGCAAAAAACGACCTATTGCTCAGGTCATCGACCTTACTGAAAGTGGTGATGAAGATGACGAGTCCC
CTCTTCCACCTCCTAAAAGGCCAGCTACAAGTCTGCCATCCCGGGCTTTTTCTCGTCAGGATTACCATGTCCCGC
CCGCCAGCAGCCCTCTGAATGGCGGGTCGTACCCACCATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail