Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g8991.t1
Gene name
Locationscaffold_40:26618..27820
Strand+
Gene length (bp)1202
Transcript length (bp)1086
Coding sequence length (bp)1086
Protein length (aa) 362

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) 5.4E-15 15 85
PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) 2.5E-15 103 172

GO

GO Term Description Terminal node
GO:0003723 RNA binding Yes
GO:0097159 organic cyclic compound binding No
GO:0005488 binding No
GO:1901363 heterocyclic compound binding No
GO:0003676 nucleic acid binding No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 87.79 53.18 122.39
5d_25C Five days - 25 degrees Celsius 88.23 53.48 122.97
7d_25C Seven days - 25 degrees Celsius 97.33 59.16 135.50
10d_25C Ten days - 25 degrees Celsius 93.67 57.04 130.29
7d_15C Seven days - 15 degrees Celsius 76.71 46.03 107.39
7d_30C Seven days - 30 degrees Celsius 83.90 50.65 117.14

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.988856 no
3d_25C 7d_25C 0.718289 no
3d_25C 7d_15C 0.619639 no
3d_25C 7d_30C 0.889137 no
3d_25C 10d_25C 0.836928 no
5d_25C 7d_25C 0.735987 no
5d_25C 7d_15C 0.605656 no
5d_25C 7d_30C 0.876241 no
5d_25C 10d_25C 0.851716 no
7d_25C 7d_15C 0.329390 no
7d_25C 7d_30C 0.585476 no
7d_25C 10d_25C 0.910799 no
7d_15C 7d_30C 0.764019 no
7d_15C 10d_25C 0.434782 no
7d_30C 10d_25C 0.698745 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g8991.t1
MSNARHWEQDKEATVYIGNLDERVSDSLVWELMLQVGRIVNVHLPKDRVTQLHQGYGFVEFISEEDAEYASKIMN
GIRLHSKPIRVNKASADKQKTVEIGAELFVGNLDPMVAEQVLFDTFSRFGNLVNPPKIARDDNNLSKGYGFVSFA
DFESSDAAISNMNGQYLMNKQVSVQYAYKKDGKGERHGDEAERMLAAQARKHNVQPPTQQPQQPSQFPGAAPGVS
ATPAMSNGDSSRPLITAQSQTPDLGMNRGIPPAMPYQSAPPPMPYQTVPPPNRHVPPPVPSINTPPPGLPARPPP
SQAGYGGPQTFLPPGFNGAGQPPFVPQAAAPPGFGPPGFGPPAGAPSLPPGFQQPGYAGSR*
Coding >Pro_DTO377G3_2|g8991.t1
ATGTCTAACGCAAGACATTGGGAACAAGATAAAGAGGCAACCGTGTACATCGGAAACCTTGATGAACGGGTTTCG
GACAGCCTTGTATGGGAGCTGATGCTACAGGTTGGGCGCATCGTCAACGTCCACCTGCCCAAAGACCGGGTCACG
CAGCTACACCAGGGGTATGGATTTGTTGAGTTCATCAGCGAGGAAGATGCCGAATATGCATCGAAGATCATGAAT
GGAATCCGTCTCCATAGCAAGCCTATTCGCGTTAACAAAGCGTCAGCCGATAAACAAAAGACCGTGGAAATCGGC
GCAGAGCTGTTTGTGGGTAACCTGGATCCTATGGTTGCCGAGCAGGTTCTGTTTGATACGTTCAGCCGGTTTGGC
AATCTTGTCAATCCGCCCAAAATTGCTCGTGATGACAACAATCTCTCTAAGGGATACGGATTTGTTTCTTTTGCC
GATTTCGAATCCTCGGACGCGGCCATCTCCAACATGAATGGCCAGTACCTGATGAACAAACAGGTTTCGGTACAG
TATGCGTACAAGAAAGATGGGAAAGGCGAGAGACATGGGGATGAAGCGGAGCGAATGCTCGCAGCCCAGGCTCGC
AAACACAACGTACAGCCACCGACTCAACAACCTCAGCAACCTTCGCAGTTCCCTGGCGCTGCGCCGGGCGTATCA
GCAACACCTGCCATGTCGAACGGCGATAGCTCTCGCCCATTGATTACGGCTCAGTCACAAACACCCGATCTAGGA
ATGAACCGGGGTATCCCGCCAGCTATGCCCTACCAGAGTGCACCCCCTCCAATGCCCTATCAGACCGTTCCCCCT
CCAAACCGACATGTTCCACCTCCCGTCCCTTCAATCAATACCCCACCTCCCGGGCTCCCAGCTCGACCTCCGCCT
TCCCAAGCTGGCTACGGTGGTCCACAGACGTTTCTACCACCTGGATTCAATGGTGCAGGTCAACCGCCCTTCGTC
CCACAAGCTGCAGCTCCCCCTGGGTTTGGACCACCTGGGTTTGGACCTCCAGCGGGAGCCCCTTCATTGCCACCG
GGCTTCCAACAGCCCGGATATGCAGGCAGTCGATGA
Transcript >Pro_DTO377G3_2|g8991.t1
ATGTCTAACGCAAGACATTGGGAACAAGATAAAGAGGCAACCGTGTACATCGGAAACCTTGATGAACGGGTTTCG
GACAGCCTTGTATGGGAGCTGATGCTACAGGTTGGGCGCATCGTCAACGTCCACCTGCCCAAAGACCGGGTCACG
CAGCTACACCAGGGGTATGGATTTGTTGAGTTCATCAGCGAGGAAGATGCCGAATATGCATCGAAGATCATGAAT
GGAATCCGTCTCCATAGCAAGCCTATTCGCGTTAACAAAGCGTCAGCCGATAAACAAAAGACCGTGGAAATCGGC
GCAGAGCTGTTTGTGGGTAACCTGGATCCTATGGTTGCCGAGCAGGTTCTGTTTGATACGTTCAGCCGGTTTGGC
AATCTTGTCAATCCGCCCAAAATTGCTCGTGATGACAACAATCTCTCTAAGGGATACGGATTTGTTTCTTTTGCC
GATTTCGAATCCTCGGACGCGGCCATCTCCAACATGAATGGCCAGTACCTGATGAACAAACAGGTTTCGGTACAG
TATGCGTACAAGAAAGATGGGAAAGGCGAGAGACATGGGGATGAAGCGGAGCGAATGCTCGCAGCCCAGGCTCGC
AAACACAACGTACAGCCACCGACTCAACAACCTCAGCAACCTTCGCAGTTCCCTGGCGCTGCGCCGGGCGTATCA
GCAACACCTGCCATGTCGAACGGCGATAGCTCTCGCCCATTGATTACGGCTCAGTCACAAACACCCGATCTAGGA
ATGAACCGGGGTATCCCGCCAGCTATGCCCTACCAGAGTGCACCCCCTCCAATGCCCTATCAGACCGTTCCCCCT
CCAAACCGACATGTTCCACCTCCCGTCCCTTCAATCAATACCCCACCTCCCGGGCTCCCAGCTCGACCTCCGCCT
TCCCAAGCTGGCTACGGTGGTCCACAGACGTTTCTACCACCTGGATTCAATGGTGCAGGTCAACCGCCCTTCGTC
CCACAAGCTGCAGCTCCCCCTGGGTTTGGACCACCTGGGTTTGGACCTCCAGCGGGAGCCCCTTCATTGCCACCG
GGCTTCCAACAGCCCGGATATGCAGGCAGTCGATGA
Gene >Pro_DTO377G3_2|g8991.t1
ATGTCTAACGCAAGACATTGGTAAGACCTTCTTTCCTCCCCACAGGGACCTGATGCTAACTTACCCCAGGGAACA
AGATAAAGAGGCAACCGTGTACATCGGAAACCTTGATGAACGGGTTTCGGACAGCCTTGTATGGGAGCTGATGCT
ACAGGTTGGGCGCATCGTCAACGTCCACCTGCCCAAAGACCGGGTCACGCAGCTACACCAGGGGTATGGATTTGT
TGAGTTCATCAGCGAGGAAGATGCCGAATATGCATCGAAGATCATGAATGGAATCCGTCTCCATAGCAAGCCTAT
TCGCGTTAACAAAGCGTCAGCCGATAAACAAAAGACCGTGGAAATCGGCGCAGAGCTGTTTGTGGGTAACCTGGA
TCCTATGGTTGCCGAGCAGGTTCTGTTTGATACGTTCAGCCGGTTTGGCAATCTTGTCAATCCGCCCAAAGTGAG
ATCTCCCCCAATACGAACAAGATGGAAATTTTTAACAGTCTCTTTTTCATATTACTTTACAGATTGCTCGTGATG
ACAACAATCTCTCTAAGGGATACGGATTTGTTTCTTTTGCCGATTTCGAATCCTCGGACGCGGCCATCTCCAACA
TGAATGGCCAGTACCTGATGAACAAACAGGTTTCGGTACAGTATGCGTACAAGAAAGATGGGAAAGGCGAGAGAC
ATGGGGATGAAGCGGAGCGAATGCTCGCAGCCCAGGCTCGCAAACACAACGTACAGCCACCGACTCAACAACCTC
AGCAACCTTCGCAGTTCCCTGGCGCTGCGCCGGGCGTATCAGCAACACCTGCCATGTCGAACGGCGATAGCTCTC
GCCCATTGATTACGGCTCAGTCACAAACACCCGATCTAGGAATGAACCGGGGTATCCCGCCAGCTATGCCCTACC
AGAGTGCACCCCCTCCAATGCCCTATCAGACCGTTCCCCCTCCAAACCGACATGTTCCACCTCCCGTCCCTTCAA
TCAATACCCCACCTCCCGGGCTCCCAGCTCGACCTCCGCCTTCCCAAGCTGGCTACGGTGGTCCACAGACGTTTC
TACCACCTGGATTCAATGGTGCAGGTCAACCGCCCTTCGTCCCACAAGCTGCAGCTCCCCCTGGGTTTGGACCAC
CTGGGTTTGGACCTCCAGCGGGAGCCCCTTCATTGCCACCGGGCTTCCAACAGCCCGGATATGCAGGCAGTCGAT
GA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail