Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g8974.t1
Gene name
Locationscaffold_39:143252..145005
Strand-
Gene length (bp)1753
Transcript length (bp)1689
Coding sequence length (bp)1689
Protein length (aa) 563

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 1.1E-33 61 460
PF06609 TRI12 Fungal trichothecene efflux pump (TRI12) 5.0E-07 58 484

GO

GO Term Description Terminal node
GO:0055085 transmembrane transport Yes
GO:0022857 transmembrane transporter activity Yes
GO:0008150 biological_process No
GO:0006810 transport No
GO:0009987 cellular process No
GO:0051234 establishment of localization No
GO:0005215 transporter activity No
GO:0003674 molecular_function No
GO:0051179 localization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.5

Transmembrane Domains

Domain # Start End Length
1 55 77 22
2 92 114 22
3 121 142 21
4 146 168 22
5 180 202 22
6 212 234 22
7 254 276 22
8 280 302 22
9 323 345 22
10 365 387 22
11 389 407 18
12 447 469 22
13 525 547 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 4.36 1.39 7.33
5d_25C Five days - 25 degrees Celsius 5.14 1.81 8.47
7d_25C Seven days - 25 degrees Celsius 5.89 2.11 9.67
10d_25C Ten days - 25 degrees Celsius 6.27 2.40 10.14
7d_15C Seven days - 15 degrees Celsius 4.51 1.46 7.57
7d_30C Seven days - 30 degrees Celsius 4.38 1.41 7.34

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.741333 no
3d_25C 7d_25C 0.494914 no
3d_25C 7d_15C 0.956928 no
3d_25C 7d_30C 0.996497 no
3d_25C 10d_25C 0.369596 no
5d_25C 7d_25C 0.781482 no
5d_25C 7d_15C 0.792243 no
5d_25C 7d_30C 0.742183 no
5d_25C 10d_25C 0.652491 no
7d_25C 7d_15C 0.551942 no
7d_25C 7d_30C 0.495275 no
7d_25C 10d_25C 0.909279 no
7d_15C 7d_30C 0.962564 no
7d_15C 10d_25C 0.424475 no
7d_30C 10d_25C 0.373676 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g8974.t1
MKLPHDKPTNPPSTADPLDPLQIQQTEKRTPTSTDDSGPLSNQNEPQYPGKAKLILIALSLSLCMFLVGLDNTII
SSAIPKITDDFNALEDVGWYASAFMLTVCSFQLMWGKLFTFYTVKWVYLASLFIFELGSLICGVAPTSTALIVGR
AIAGIGGGGVSNGSFLLIAYSVPPRQRPMLIGALGAMYGFSAIAGPLIGGAFTNNAKLTWRWCFYINLPLGFVAG
LVILFFVSSFKGSKAGKLGFINQLRQMDIPGTLCLLPGIICLLLALQWGGTKYPWASGRIIALFVVAFVILVAFG
FVQLRSGELATVPKRIFYNRNIWGSSLFGSCIVAAFFVILYYIQIWFQAIKGATPIKSGVMSLPLVLSYVLFSFV
TGGLTSVFGYYVQWAYIAVAFMAIGAGLLTMLDVNSGHAEWIGYQVILGAGVGCGLQTAFSAPQTALSLEDIPIG
TAVVIFTENLTSAVFVSVAQNVFTNQLKTNMAQYAPDVDATEIIAAGATKFKSQVPKELYDVVLLAYNKALDQTF
YVSVALSCFGILGVLGLEWLSVKGKNDDTSDDTHAKS*
Coding >Pro_DTO377G3_2|g8974.t1
ATGAAGCTCCCCCATGACAAACCCACCAATCCGCCATCTACAGCAGATCCTCTAGATCCTCTGCAAATACAACAG
ACTGAAAAACGTACACCAACGTCAACCGATGATTCTGGGCCTCTCAGCAACCAGAACGAACCTCAGTACCCCGGA
AAGGCCAAGCTCATCCTCATCGCTCTCAGCTTGAGCCTCTGCATGTTCCTTGTGGGGCTAGACAACACAATTATT
TCCAGCGCCATCCCTAAAATCACCGATGATTTCAACGCATTAGAAGATGTTGGGTGGTACGCGAGTGCCTTCATG
CTCACAGTATGTTCATTCCAGCTGATGTGGGGAAAGCTTTTCACATTCTACACCGTCAAATGGGTCTACTTGGCC
TCCCTGTTTATTTTTGAACTGGGCTCTTTGATCTGTGGTGTTGCACCTACATCCACTGCTCTGATTGTGGGGCGT
GCTATTGCCGGAATCGGTGGTGGTGGTGTCTCAAACGGTTCGTTTTTATTGATCGCCTACTCGGTGCCGCCACGC
CAACGTCCTATGTTGATTGGGGCCCTTGGTGCTATGTACGGATTTTCTGCCATTGCTGGTCCTTTGATAGGGGGT
GCCTTCACCAATAACGCCAAACTCACTTGGAGGTGGTGTTTCTACATTAACCTTCCTCTTGGGTTTGTTGCTGGT
CTGGTCATTTTATTCTTCGTTTCTTCTTTCAAAGGAAGTAAGGCAGGTAAACTCGGCTTCATCAATCAACTGAGG
CAGATGGATATTCCCGGTACCCTCTGTTTACTTCCTGGTATCATTTGTTTGCTCCTTGCCCTGCAATGGGGTGGT
ACCAAATACCCATGGGCCAGCGGGCGAATCATTGCTCTGTTTGTAGTGGCCTTCGTGATTTTGGTCGCATTTGGG
TTTGTTCAGCTTCGGTCCGGTGAACTTGCAACCGTCCCCAAGAGGATTTTCTACAACCGCAATATTTGGGGCTCA
TCTTTGTTCGGCTCATGCATCGTCGCTGCGTTTTTCGTCATACTCTATTACATTCAAATTTGGTTCCAAGCCATC
AAGGGAGCCACCCCAATCAAGTCCGGTGTCATGAGTCTTCCTCTTGTACTGAGCTACGTGCTCTTCTCGTTCGTG
ACGGGCGGTCTTACTTCGGTGTTTGGGTACTACGTACAATGGGCCTATATTGCGGTGGCTTTCATGGCAATCGGA
GCCGGTCTGCTCACCATGCTAGACGTCAACTCCGGCCACGCAGAATGGATTGGATATCAAGTGATTCTTGGAGCG
GGAGTTGGGTGTGGTTTACAGACAGCATTCTCCGCACCCCAAACTGCGCTATCATTGGAGGATATCCCCATCGGC
ACCGCTGTTGTTATATTCACGGAGAATCTCACCAGTGCGGTCTTCGTCTCCGTTGCGCAGAATGTGTTCACAAAT
CAGCTGAAAACAAATATGGCGCAATATGCTCCGGATGTTGATGCCACTGAAATTATTGCAGCCGGCGCAACGAAA
TTCAAGAGCCAAGTGCCTAAGGAGCTCTACGATGTTGTCCTGCTTGCTTACAACAAGGCCCTAGATCAGACATTC
TACGTGAGCGTCGCCCTCTCTTGCTTTGGTATTCTCGGTGTATTGGGGCTGGAGTGGCTCTCTGTCAAAGGAAAG
AACGACGATACTTCTGATGATACCCATGCCAAGTCATGA
Transcript >Pro_DTO377G3_2|g8974.t1
ATGAAGCTCCCCCATGACAAACCCACCAATCCGCCATCTACAGCAGATCCTCTAGATCCTCTGCAAATACAACAG
ACTGAAAAACGTACACCAACGTCAACCGATGATTCTGGGCCTCTCAGCAACCAGAACGAACCTCAGTACCCCGGA
AAGGCCAAGCTCATCCTCATCGCTCTCAGCTTGAGCCTCTGCATGTTCCTTGTGGGGCTAGACAACACAATTATT
TCCAGCGCCATCCCTAAAATCACCGATGATTTCAACGCATTAGAAGATGTTGGGTGGTACGCGAGTGCCTTCATG
CTCACAGTATGTTCATTCCAGCTGATGTGGGGAAAGCTTTTCACATTCTACACCGTCAAATGGGTCTACTTGGCC
TCCCTGTTTATTTTTGAACTGGGCTCTTTGATCTGTGGTGTTGCACCTACATCCACTGCTCTGATTGTGGGGCGT
GCTATTGCCGGAATCGGTGGTGGTGGTGTCTCAAACGGTTCGTTTTTATTGATCGCCTACTCGGTGCCGCCACGC
CAACGTCCTATGTTGATTGGGGCCCTTGGTGCTATGTACGGATTTTCTGCCATTGCTGGTCCTTTGATAGGGGGT
GCCTTCACCAATAACGCCAAACTCACTTGGAGGTGGTGTTTCTACATTAACCTTCCTCTTGGGTTTGTTGCTGGT
CTGGTCATTTTATTCTTCGTTTCTTCTTTCAAAGGAAGTAAGGCAGGTAAACTCGGCTTCATCAATCAACTGAGG
CAGATGGATATTCCCGGTACCCTCTGTTTACTTCCTGGTATCATTTGTTTGCTCCTTGCCCTGCAATGGGGTGGT
ACCAAATACCCATGGGCCAGCGGGCGAATCATTGCTCTGTTTGTAGTGGCCTTCGTGATTTTGGTCGCATTTGGG
TTTGTTCAGCTTCGGTCCGGTGAACTTGCAACCGTCCCCAAGAGGATTTTCTACAACCGCAATATTTGGGGCTCA
TCTTTGTTCGGCTCATGCATCGTCGCTGCGTTTTTCGTCATACTCTATTACATTCAAATTTGGTTCCAAGCCATC
AAGGGAGCCACCCCAATCAAGTCCGGTGTCATGAGTCTTCCTCTTGTACTGAGCTACGTGCTCTTCTCGTTCGTG
ACGGGCGGTCTTACTTCGGTGTTTGGGTACTACGTACAATGGGCCTATATTGCGGTGGCTTTCATGGCAATCGGA
GCCGGTCTGCTCACCATGCTAGACGTCAACTCCGGCCACGCAGAATGGATTGGATATCAAGTGATTCTTGGAGCG
GGAGTTGGGTGTGGTTTACAGACAGCATTCTCCGCACCCCAAACTGCGCTATCATTGGAGGATATCCCCATCGGC
ACCGCTGTTGTTATATTCACGGAGAATCTCACCAGTGCGGTCTTCGTCTCCGTTGCGCAGAATGTGTTCACAAAT
CAGCTGAAAACAAATATGGCGCAATATGCTCCGGATGTTGATGCCACTGAAATTATTGCAGCCGGCGCAACGAAA
TTCAAGAGCCAAGTGCCTAAGGAGCTCTACGATGTTGTCCTGCTTGCTTACAACAAGGCCCTAGATCAGACATTC
TACGTGAGCGTCGCCCTCTCTTGCTTTGGTATTCTCGGTGTATTGGGGCTGGAGTGGCTCTCTGTCAAAGGAAAG
AACGACGATACTTCTGATGATACCCATGCCAAGTCATGA
Gene >Pro_DTO377G3_2|g8974.t1
ATGAAGCTCCCCCATGACAAACCCACCAATCCGCCATCTACAGCAGATCCTCTAGATCCTCTGCAAATACAACAG
ACTGAAAAACGTACACCAACGTCAACCGATGATTCTGGGCCTCTCAGCAACCAGAACGAACCTCAGTACCCCGGA
AAGGCCAAGCTCATCCTCATCGCTCTCAGCTTGAGCCTCTGCATGTTCCTTGTGGGGCTAGACAACACAATTATT
TCCAGCGCCATCCCTAAAATCACCGATGATTTCAACGCATTAGAAGATGTTGGGTGGTACGCGAGTGCCTTCATG
CTCACAGTATGTTCATTCCAGCTGATGTGGGGAAAGCTTTTCACATTCTACACCGTCAAATGGGTCTACTTGGCC
TCCCTGTTTATTTTTGAACTGGGCTCTTTGATCTGTGGTGTTGCACCTACATCCACTGCTCTGATTGTGGGGCGT
GCTATTGCCGGAATCGGTGGTGGTGGTGTCTCAAACGGTTCGTTTTTATTGATCGCCTACTCGGTGCCGCCACGC
CAACGTCCTATGTTGATTGGGGCCCTTGGTGCTATGTACGGATTTTCTGCCATTGCTGGTCCTTTGATAGGGGGT
GCCTTCACCAATAACGCCAAACTCACTTGGAGGTGGTGTTTCTACATTAACCTTCCTCTTGGGTTTGTTGCTGGT
CTGGTCATTTTATTCTTCGTTTCTTCTTTCAAAGGAAGTAAGGCAGGTAAACTCGGCTTCATCAATCAACTGAGG
CAGATGGATATTCCCGGTACCCTCTGTTTACTTCCTGGTATCATTTGTTTGCTCCTTGCCCTGCAATGGGGTGGT
ACCAAATACCCATGGGCCAGCGGGCGAATCATTGCTCTGTTTGTAGTGGCCTTCGTGATTTTGGTCGCATTTGGG
TTTGTTCAGCTTCGGTCCGGTGAACTTGCAACCGTCCCCAAGAGGATTTTCTACAACCGCAATATTTGGGGCTCA
TCTTTGTTCGGCTCATGCATCGTCGCTGCGTTTTTCGTCATACTCTATTACGTGTGTATAGCTCCTTGTGAGGTT
GGATAAACCCTAAATTACAGCATACTAACTTGTTCGTCAGATTCAAATTTGGTTCCAAGCCATCAAGGGAGCCAC
CCCAATCAAGTCCGGTGTCATGAGTCTTCCTCTTGTACTGAGCTACGTGCTCTTCTCGTTCGTGACGGGCGGTCT
TACTTCGGTGTTTGGGTACTACGTACAATGGGCCTATATTGCGGTGGCTTTCATGGCAATCGGAGCCGGTCTGCT
CACCATGCTAGACGTCAACTCCGGCCACGCAGAATGGATTGGATATCAAGTGATTCTTGGAGCGGGAGTTGGGTG
TGGTTTACAGACAGCATTCTCCGCACCCCAAACTGCGCTATCATTGGAGGATATCCCCATCGGCACCGCTGTTGT
TATATTCACGGAGAATCTCACCAGTGCGGTCTTCGTCTCCGTTGCGCAGAATGTGTTCACAAATCAGCTGAAAAC
AAATATGGCGCAATATGCTCCGGATGTTGATGCCACTGAAATTATTGCAGCCGGCGCAACGAAATTCAAGAGCCA
AGTGCCTAAGGAGCTCTACGATGTTGTCCTGCTTGCTTACAACAAGGCCCTAGATCAGACATTCTACGTGAGCGT
CGCCCTCTCTTGCTTTGGTATTCTCGGTGTATTGGGGCTGGAGTGGCTCTCTGTCAAAGGAAAGAACGACGATAC
TTCTGATGATACCCATGCCAAGTCATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail