Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g8957.t1
Gene name
Locationscaffold_39:92705..94785
Strand+
Gene length (bp)2080
Transcript length (bp)1848
Coding sequence length (bp)1848
Protein length (aa) 616

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13347 MFS_2 MFS/sugar transport protein 2.6E-10 72 313
PF03209 PUCC PUCC protein 3.9E-05 82 193

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 63 0.5

Transmembrane Domains

Domain # Start End Length
1 44 61 17
2 81 103 22
3 116 135 19
4 155 177 22
5 198 215 17
6 230 252 22
7 295 317 22
8 347 369 22
9 437 459 22
10 469 491 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g8957.t1
MGALNFKPAPGYIDESSPLMVATRSAERRGVRPFAGADESSKNALYMFLLTLSIGGLQIVWSVELSNGSPFLLSL
GMSKSLLAFVWIASPLTGALVQPYIGIRSDNCRLAWGKRKPFMVIGGAATVVSLLALAWVKEIVGGVLSIFGVET
SAIKIVIIIMATIFMCCLDFAINTVQAAARAFIVDNCPTHQQELSNAWASRMVGVGNILGYIFGYMDLPKVVPFL
GNTQFKVLCVLASVFLSTTVAISCIYIQERDPREDGPVTDKLGLVSFFKQVIKSIRSLPTQISRVCEVQIAAWVG
WFPFLYYSTTYIGQLYVNPIFADNPHLSEGEVDKAWEDATRVGTLALLIYAIISFLSNMLLPLFVVPLYGPAPET
VSQRDSLDGDLDGDSEPAARRLSFSSIPTGNASEPLLDVPVGQETEEKPTWLSRLRIPGLTLPRVWLLSHLLFAA
CMFSTFFIYSHQAGSAFVGLVGVSWAVALWAPFALISAEVARIDPSRRNRRRAAQTTYTEHADEAQDEGPGELDS
VGGSDIENGHPKDYRDNGDVAQAGIILGLHNMAVSLPQILSSLVCSAIFKASQKQRGEPWDDSVGWVLRFGGCAA
LVAAWLTRRVSDGSR*
Coding >Pro_DTO377G3_2|g8957.t1
ATGGGAGCCTTGAATTTCAAGCCTGCCCCTGGTTATATTGACGAGAGCTCGCCTCTCATGGTTGCTACTCGCTCT
GCGGAGAGGCGTGGTGTGCGCCCTTTTGCCGGTGCCGATGAGTCGTCTAAGAATGCGCTGTACATGTTCCTTTTG
ACTCTTTCTATTGGTGGACTTCAGATTGTTTGGTCTGTCGAACTTTCTAATGGATCGCCATTCCTTCTATCCCTT
GGGATGAGCAAGTCGCTTCTTGCCTTTGTTTGGATAGCCAGTCCCTTGACGGGCGCACTGGTGCAACCATACATC
GGTATTCGAAGCGACAACTGCCGACTCGCGTGGGGTAAGAGGAAACCATTTATGGTCATTGGAGGTGCAGCAACT
GTCGTTTCATTGCTAGCTCTGGCATGGGTGAAAGAGATTGTGGGAGGTGTTCTGTCTATATTCGGGGTTGAAACA
TCAGCGATTAAGATTGTTATCATTATCATGGCAACAATTTTCATGTGTTGCCTTGATTTTGCCATTAACACCGTG
CAAGCTGCAGCCAGAGCATTTATTGTCGACAACTGCCCTACCCACCAGCAGGAGCTGTCCAACGCCTGGGCCAGT
CGTATGGTCGGCGTTGGTAATATCTTAGGGTATATCTTTGGCTATATGGACCTGCCAAAGGTTGTCCCTTTCTTG
GGAAATACCCAGTTCAAGGTCCTGTGCGTACTTGCCTCGGTCTTTCTGAGCACAACTGTTGCCATTAGTTGCATC
TATATCCAAGAGCGGGATCCCCGAGAAGACGGGCCCGTGACTGACAAGCTTGGCTTGGTCTCCTTTTTCAAACAG
GTCATCAAGTCCATTCGGAGCTTGCCAACGCAGATTTCCCGCGTCTGTGAGGTGCAGATCGCAGCGTGGGTGGGC
TGGTTCCCGTTCCTGTACTACTCCACGACCTATATCGGGCAGCTGTACGTCAATCCAATATTCGCGGATAATCCC
CATCTCTCCGAGGGTGAGGTTGATAAGGCCTGGGAAGATGCTACTCGCGTCGGGACATTGGCCCTCCTTATCTAT
GCTATCATCTCTTTTCTTTCCAATATGTTGCTTCCTCTCTTCGTGGTCCCCTTGTATGGACCGGCGCCAGAGACT
GTTTCGCAACGGGATTCCCTAGACGGTGATTTAGATGGTGATTCAGAGCCAGCTGCAAGGAGACTATCTTTTTCA
AGCATCCCGACAGGCAATGCATCCGAGCCTCTGCTTGACGTTCCAGTCGGACAAGAGACCGAAGAGAAACCCACT
TGGCTTTCTCGCCTGCGCATCCCAGGCTTGACGCTCCCGAGGGTCTGGCTCCTCTCCCATCTCCTCTTCGCGGCG
TGCATGTTCAGCACTTTCTTCATCTACTCTCATCAAGCCGGGTCGGCATTTGTGGGCCTTGTCGGTGTCTCATGG
GCTGTAGCATTGTGGGCTCCTTTCGCTCTTATCTCGGCGGAGGTAGCTAGGATTGATCCTTCTAGACGAAATCGT
CGCCGAGCGGCTCAGACTACTTATACCGAGCATGCAGATGAGGCCCAGGATGAGGGTCCCGGTGAACTTGACAGC
GTCGGTGGCAGTGATATTGAGAATGGACACCCGAAAGATTATCGTGATAATGGGGATGTTGCACAGGCGGGTATC
ATTCTTGGACTGCATAATATGGCTGTTTCTCTCCCCCAGATTCTGTCTAGTCTTGTTTGCAGTGCTATCTTCAAG
GCATCCCAGAAGCAAAGAGGGGAGCCGTGGGATGATAGCGTGGGCTGGGTGCTACGGTTTGGTGGATGTGCTGCG
TTGGTGGCTGCATGGTTGACTAGAAGGGTTTCGGATGGATCAAGATAG
Transcript >Pro_DTO377G3_2|g8957.t1
ATGGGAGCCTTGAATTTCAAGCCTGCCCCTGGTTATATTGACGAGAGCTCGCCTCTCATGGTTGCTACTCGCTCT
GCGGAGAGGCGTGGTGTGCGCCCTTTTGCCGGTGCCGATGAGTCGTCTAAGAATGCGCTGTACATGTTCCTTTTG
ACTCTTTCTATTGGTGGACTTCAGATTGTTTGGTCTGTCGAACTTTCTAATGGATCGCCATTCCTTCTATCCCTT
GGGATGAGCAAGTCGCTTCTTGCCTTTGTTTGGATAGCCAGTCCCTTGACGGGCGCACTGGTGCAACCATACATC
GGTATTCGAAGCGACAACTGCCGACTCGCGTGGGGTAAGAGGAAACCATTTATGGTCATTGGAGGTGCAGCAACT
GTCGTTTCATTGCTAGCTCTGGCATGGGTGAAAGAGATTGTGGGAGGTGTTCTGTCTATATTCGGGGTTGAAACA
TCAGCGATTAAGATTGTTATCATTATCATGGCAACAATTTTCATGTGTTGCCTTGATTTTGCCATTAACACCGTG
CAAGCTGCAGCCAGAGCATTTATTGTCGACAACTGCCCTACCCACCAGCAGGAGCTGTCCAACGCCTGGGCCAGT
CGTATGGTCGGCGTTGGTAATATCTTAGGGTATATCTTTGGCTATATGGACCTGCCAAAGGTTGTCCCTTTCTTG
GGAAATACCCAGTTCAAGGTCCTGTGCGTACTTGCCTCGGTCTTTCTGAGCACAACTGTTGCCATTAGTTGCATC
TATATCCAAGAGCGGGATCCCCGAGAAGACGGGCCCGTGACTGACAAGCTTGGCTTGGTCTCCTTTTTCAAACAG
GTCATCAAGTCCATTCGGAGCTTGCCAACGCAGATTTCCCGCGTCTGTGAGGTGCAGATCGCAGCGTGGGTGGGC
TGGTTCCCGTTCCTGTACTACTCCACGACCTATATCGGGCAGCTGTACGTCAATCCAATATTCGCGGATAATCCC
CATCTCTCCGAGGGTGAGGTTGATAAGGCCTGGGAAGATGCTACTCGCGTCGGGACATTGGCCCTCCTTATCTAT
GCTATCATCTCTTTTCTTTCCAATATGTTGCTTCCTCTCTTCGTGGTCCCCTTGTATGGACCGGCGCCAGAGACT
GTTTCGCAACGGGATTCCCTAGACGGTGATTTAGATGGTGATTCAGAGCCAGCTGCAAGGAGACTATCTTTTTCA
AGCATCCCGACAGGCAATGCATCCGAGCCTCTGCTTGACGTTCCAGTCGGACAAGAGACCGAAGAGAAACCCACT
TGGCTTTCTCGCCTGCGCATCCCAGGCTTGACGCTCCCGAGGGTCTGGCTCCTCTCCCATCTCCTCTTCGCGGCG
TGCATGTTCAGCACTTTCTTCATCTACTCTCATCAAGCCGGGTCGGCATTTGTGGGCCTTGTCGGTGTCTCATGG
GCTGTAGCATTGTGGGCTCCTTTCGCTCTTATCTCGGCGGAGGTAGCTAGGATTGATCCTTCTAGACGAAATCGT
CGCCGAGCGGCTCAGACTACTTATACCGAGCATGCAGATGAGGCCCAGGATGAGGGTCCCGGTGAACTTGACAGC
GTCGGTGGCAGTGATATTGAGAATGGACACCCGAAAGATTATCGTGATAATGGGGATGTTGCACAGGCGGGTATC
ATTCTTGGACTGCATAATATGGCTGTTTCTCTCCCCCAGATTCTGTCTAGTCTTGTTTGCAGTGCTATCTTCAAG
GCATCCCAGAAGCAAAGAGGGGAGCCGTGGGATGATAGCGTGGGCTGGGTGCTACGGTTTGGTGGATGTGCTGCG
TTGGTGGCTGCATGGTTGACTAGAAGGGTTTCGGATGGATCAAGATAG
Gene >Pro_DTO377G3_2|g8957.t1
ATGGGAGCCTTGAATTTCAAGCCTGCCCCTGGTTATATTGACGAGAGCTCGCCTCTCATGGTTGCTACTCGCTCT
GCGGAGAGGCGTGGTGTGCGCCCTTTTGCCGGTGCCGATGAGTCGTCTAAGAATGCGCTGTACATGTTCCTTTTG
ACTCTTTCTATTGGTGGGTGAGTAGTTTTGTATGGGGTGATTTGACTTGTGGTCATTTATTGATATTGGGTTTCT
TTGACAGACTTCAGATTGTTTGGTCTGTCGAACTTTCTAATGGATCGGTAAGTATAAGTCGCGACTTACAGGAGA
TGATTTGACCCCAACTTTGCACCTTACCCCTTTCATTTCCGAAGCTGTAAGACTGAATAAAAGAACATGCTGACG
GGTTACAGCCATTCCTTCTATCCCTTGGGATGAGCAAGTCGCTTCTTGCCTTTGTTTGGATAGCCAGTCCCTTGA
CGGGCGCACTGGTGCAACCATACATCGGTATTCGAAGCGACAACTGCCGACTCGCGTGGGGTAAGAGGAAACCAT
TTATGGTCATTGGAGGTGCAGCAACTGTCGTTTCATTGCTAGCTCTGGCATGGGTGAAAGAGATTGTGGGAGGTG
TTCTGTCTATATTCGGGGTTGAAACATCAGCGATTAAGATTGTTATCATTATCATGGCAACAATTTTCATGTGTT
GCCTTGATTTTGCCATTAACACCGGTGCGCATTCCATCTTCACTTTTTTAATGGTTACTTGGCTAATCTTCGTCC
TATAGTGCAAGCTGCAGCCAGAGCATTTATTGTCGACAACTGCCCTACCCACCAGCAGGAGCTGTCCAACGCCTG
GGCCAGTCGTATGGTCGGCGTTGGTAATATCTTAGGGTATATCTTTGGCTATATGGACCTGCCAAAGGTTGTCCC
TTTCTTGGGAAATACCCAGTTCAAGGTCCTGTGCGTACTTGCCTCGGTCTTTCTGAGCACAACTGTTGCCATTAG
TTGCATCTATATCCAAGAGCGGGATCCCCGAGAAGACGGGCCCGTGACTGACAAGCTTGGCTTGGTCTCCTTTTT
CAAACAGGTCATCAAGTCCATTCGGAGCTTGCCAACGCAGATTTCCCGCGTCTGTGAGGTGCAGATCGCAGCGTG
GGTGGGCTGGTTCCCGTTCCTGTACTACTCCACGACCTATATCGGGCAGCTGTACGTCAATCCAATATTCGCGGA
TAATCCCCATCTCTCCGAGGGTGAGGTTGATAAGGCCTGGGAAGATGCTACTCGCGTCGGGACATTGGCCCTCCT
TATCTATGCTATCATCTCTTTTCTTTCCAATATGTTGCTTCCTCTCTTCGTGGTCCCCTTGTATGGACCGGCGCC
AGAGACTGTTTCGCAACGGGATTCCCTAGACGGTGATTTAGATGGTGATTCAGAGCCAGCTGCAAGGAGACTATC
TTTTTCAAGCATCCCGACAGGCAATGCATCCGAGCCTCTGCTTGACGTTCCAGTCGGACAAGAGACCGAAGAGAA
ACCCACTTGGCTTTCTCGCCTGCGCATCCCAGGCTTGACGCTCCCGAGGGTCTGGCTCCTCTCCCATCTCCTCTT
CGCGGCGTGCATGTTCAGCACTTTCTTCATCTACTCTCATCAAGCCGGGTCGGCATTTGTGGGCCTTGTCGGTGT
CTCATGGGCTGTAGCATTGTGGGCTCCTTTCGCTCTTATCTCGGCGGAGGTAGCTAGGATTGATCCTTCTAGACG
AAATCGTCGCCGAGCGGCTCAGACTACTTATACCGAGCATGCAGATGAGGCCCAGGATGAGGGTCCCGGTGAACT
TGACAGCGTCGGTGGCAGTGATATTGAGAATGGACACCCGAAAGATTATCGTGATAATGGGGATGTTGCACAGGC
GGGTATCATTCTTGGACTGCATAATATGGCTGTTTCTCTCCCCCAGATTCTGTCTAGTCTTGTTTGCAGTGCTAT
CTTCAAGGCATCCCAGAAGCAAAGAGGGGAGCCGTGGGATGATAGCGTGGGCTGGGTGCTACGGTTTGGTGGATG
TGCTGCGTTGGTGGCTGCATGGTTGACTAGAAGGGTTTCGGATGGATCAAGATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail