Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g895.t1
Gene name
Locationscaffold_01:2384410..2387592
Strand+
Gene length (bp)3182
Transcript length (bp)2991
Coding sequence length (bp)2991
Protein length (aa) 997

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12796 Ank_2 Ankyrin repeats (3 copies) 5.1E-12 636 701
PF12796 Ank_2 Ankyrin repeats (3 copies) 1.9E-10 709 769
PF12796 Ank_2 Ankyrin repeats (3 copies) 2.1E-10 775 836
PF12796 Ank_2 Ankyrin repeats (3 copies) 2.3E-10 839 898
PF12796 Ank_2 Ankyrin repeats (3 copies) 8.4E-10 908 991
PF00023 Ank Ankyrin repeat 7.6E-05 674 701
PF00023 Ank Ankyrin repeat 7.6E-03 807 836
PF00023 Ank Ankyrin repeat 4.1E-04 839 867
PF00023 Ank Ankyrin repeat 2.9E-03 873 899
PF00023 Ank Ankyrin repeat 1.7E-02 938 961
PF13637 Ank_4 Ankyrin repeats (many copies) 1.4E-05 645 694
PF13637 Ank_4 Ankyrin repeats (many copies) 5.7E-06 710 761
PF13637 Ank_4 Ankyrin repeats (many copies) 5.0E-08 839 890
PF13637 Ank_4 Ankyrin repeats (many copies) 4.6E-05 905 955
PF13606 Ank_3 Ankyrin repeat 1.9E-03 674 701
PF05729 NACHT NACHT domain 3.2E-06 207 365

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0005488 binding No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 18 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g895.t1
MSFGVSIGDFISVLTLANKLRRDFVGAPSQFNSISREVRGLAIILQDVDVQLLGHDTNDQQQNQLGQISHSCVIL
LNELQNALEKYKLVEYSGTSIHKKARGIWKRIVWEPEDISELRGRLMSNVILLQSFLSAISSQTMAATKQTLEQL
NYRQEGNEKSCILDWLSAVDYTLQQSDLLGRRQGGTGKWLLDSQEYKHWLRTRRGTLFCPGMPGAGKTICSAILV
DDLTTRFEDTPDVGIAYIYCNFNRQDEQTAQELLSSLLKQLSQKKTSVPDAVKDLYKRYKTASTRPRFDEISKTL
HSLVSTYSDVFIVIDALDECESTCRTRVLDELNKLRAGPGANVFATSRPTEINDLFEGGSVLEIQAQEDDVRRYL
AGNMFRLPGFVSRNTALQEEIMTAISRHVQGMFLLAQLYFESLIGRRSPKSTRTALKEFSKGFNDYAYDKAYDDA
MSRIQGQLREQTDLAIQTLSWLTCARRPLTSLELQHALAIEEGESSLDEENIPEIEDILTVCAGLVTVENESGII
RLVHYTTQEYLERKKDMLFPSAETEISMLCVTYISFDTFGSGICESDEAFEERLESHPFYRYAVRHWGDHVRTTK
DLHPDVIEFLKNQSKVEASEQALHVRRHSIPKDWSQNFPREKTGLHLAADRGIEAAVSYFLQHQHSVDVRHNGGW
TALQYAISRDHLNVVKLLLSCGADANGTGQDNFTSPLSLAAQYGQEDIVRLLLEREVDVDGQTGWYQTALIAACD
KGYLNIVETLLNNNANINAESEIHGTPLAAASEAGHWKIVTFLLEKGATPSSQGNEGETALASAALQGQEDIVQI
LLDHHADVNQREGTALIAACRSGHEQVVRILLANGADPNAGNGGHSSALVAASMNGNQQIVHMLLESGANINAES
YLGPALVAAAKTGNDHIVKVLLENGAEIHGRGKVQGCALHAAASRGDSQIVQMLLDRGADSTIRAGVYKTPLRAA
LMGGHQEVAALLKRQGQQLRV*
Coding >Pro_DTO377G3_2|g895.t1
ATGAGTTTTGGAGTGAGCATCGGGGACTTCATTTCGGTTCTTACTTTGGCTAATAAGCTCCGAAGAGACTTTGTT
GGCGCTCCGAGCCAGTTCAACAGTATCTCCAGAGAGGTCAGGGGGCTGGCAATTATTCTCCAGGATGTCGATGTT
CAACTACTGGGCCATGATACCAATGATCAACAACAAAACCAACTAGGGCAAATCAGTCACAGCTGTGTGATCCTG
CTGAACGAGCTTCAAAATGCTCTGGAGAAATATAAACTCGTTGAATACAGTGGCACATCAATTCACAAAAAAGCT
AGAGGTATTTGGAAGAGGATTGTCTGGGAGCCGGAGGACATAAGTGAGCTCCGAGGTCGCCTAATGTCTAATGTG
ATATTGCTCCAGTCATTTTTGAGTGCTATATCAAGTCAAACGATGGCTGCGACAAAGCAAACACTGGAACAGCTC
AACTACAGACAAGAAGGCAATGAAAAGTCTTGCATTCTCGACTGGCTGTCTGCCGTGGATTACACGTTACAGCAG
AGTGATCTTCTCGGTCGACGACAAGGGGGAACTGGGAAATGGCTTCTCGATTCGCAAGAATATAAACATTGGCTT
CGAACACGCCGAGGCACCTTGTTTTGTCCCGGAATGCCGGGTGCGGGAAAGACCATCTGTTCTGCTATCCTTGTC
GATGATTTGACTACGCGCTTTGAGGATACCCCAGATGTCGGAATAGCTTACATTTATTGCAACTTCAATCGACAA
GATGAACAGACAGCTCAAGAGTTGCTTTCAAGTCTGTTGAAGCAATTAAGTCAGAAGAAGACATCTGTTCCGGAT
GCAGTCAAGGACCTATACAAGCGCTACAAAACTGCATCGACGCGTCCCCGATTCGATGAAATATCGAAAACTCTG
CATTCACTCGTTTCCACGTATTCCGATGTGTTTATTGTCATCGATGCCCTCGATGAGTGCGAATCCACTTGCCGT
ACCAGGGTTTTGGACGAGCTCAATAAACTTCGTGCCGGGCCTGGAGCAAATGTCTTCGCCACATCAAGACCTACA
GAAATTAATGATTTGTTTGAAGGGGGTTCCGTTCTGGAGATCCAGGCACAAGAAGACGACGTTAGACGGTACCTT
GCTGGGAATATGTTCCGACTCCCGGGGTTTGTAAGCCGAAATACTGCATTGCAAGAGGAGATTATGACTGCAATC
TCACGCCATGTACAGGGAATGTTTCTCCTTGCACAGCTTTATTTTGAGTCACTGATCGGTAGAAGGTCACCTAAA
TCTACTCGAACCGCTCTGAAAGAGTTTTCGAAGGGGTTTAATGACTATGCATACGACAAGGCCTATGACGACGCG
ATGAGCCGCATTCAAGGGCAACTGAGAGAGCAAACTGATTTGGCGATACAAACTCTATCTTGGCTCACATGCGCG
AGAAGGCCACTCACTTCATTGGAACTGCAGCATGCTCTTGCAATAGAAGAAGGAGAATCTAGTCTTGACGAGGAG
AACATTCCGGAGATTGAAGACATCCTTACTGTGTGCGCTGGTCTTGTTACCGTTGAAAATGAAAGCGGGATAATT
CGACTGGTCCATTATACAACGCAAGAATACCTCGAGCGGAAGAAAGATATGCTCTTTCCCAGCGCCGAAACTGAA
ATCAGCATGTTATGTGTCACTTACATCTCGTTCGACACGTTTGGGTCTGGGATTTGTGAAAGTGATGAAGCGTTT
GAGGAGCGTCTAGAATCACATCCATTCTACCGTTATGCGGTACGCCATTGGGGCGACCATGTGAGAACAACCAAA
GATCTGCATCCTGACGTGATAGAGTTTCTGAAAAACCAGTCGAAAGTTGAAGCTTCAGAACAAGCACTCCATGTC
AGGAGGCACTCAATCCCAAAAGATTGGAGCCAGAATTTTCCAAGGGAAAAGACGGGACTGCATCTCGCTGCAGAC
CGTGGAATTGAGGCAGCAGTATCCTACTTTCTTCAACACCAGCACTCCGTGGACGTACGTCATAACGGTGGCTGG
ACAGCATTGCAATATGCCATTTCAAGAGACCACCTGAATGTCGTCAAGTTACTTCTTTCCTGTGGAGCTGATGCA
AACGGAACAGGTCAGGATAATTTCACCAGCCCACTTTCACTTGCTGCCCAGTACGGACAAGAGGACATTGTCAGA
CTTCTTCTTGAGCGCGAAGTTGACGTTGATGGCCAGACTGGATGGTACCAAACCGCACTCATCGCAGCGTGTGAC
AAGGGCTATCTAAATATCGTTGAAACTCTCCTTAACAACAATGCAAATATCAATGCCGAAAGTGAGATACATGGT
ACACCCCTCGCTGCTGCGTCAGAGGCGGGTCACTGGAAAATTGTGACCTTCTTACTTGAGAAGGGGGCTACACCC
AGTTCTCAAGGGAACGAGGGTGAAACCGCTTTGGCATCAGCAGCATTACAGGGCCAGGAAGATATCGTACAAATC
TTGCTCGATCATCATGCGGATGTCAACCAACGAGAAGGAACTGCCCTCATAGCGGCTTGTCGCAGCGGGCATGAG
CAAGTGGTACGAATACTCCTGGCTAATGGTGCCGACCCGAATGCGGGAAACGGAGGACATAGCAGCGCACTGGTA
GCAGCTTCGATGAACGGAAATCAGCAAATAGTGCACATGCTCCTCGAGAGCGGTGCCAACATCAACGCGGAAAGT
TATCTCGGACCAGCACTAGTTGCTGCTGCAAAAACGGGGAACGACCACATAGTCAAGGTGCTACTCGAAAATGGT
GCTGAGATTCACGGCCGTGGCAAAGTCCAGGGATGCGCATTACATGCAGCTGCTTCCCGCGGAGATAGCCAGATA
GTGCAAATGCTCCTCGACAGAGGTGCCGACAGCACCATTCGTGCTGGTGTTTACAAAACGCCCCTGCGAGCAGCC
TTGATGGGAGGTCATCAGGAGGTTGCCGCGCTTCTCAAAAGACAGGGGCAGCAGTTGAGGGTCTGA
Transcript >Pro_DTO377G3_2|g895.t1
ATGAGTTTTGGAGTGAGCATCGGGGACTTCATTTCGGTTCTTACTTTGGCTAATAAGCTCCGAAGAGACTTTGTT
GGCGCTCCGAGCCAGTTCAACAGTATCTCCAGAGAGGTCAGGGGGCTGGCAATTATTCTCCAGGATGTCGATGTT
CAACTACTGGGCCATGATACCAATGATCAACAACAAAACCAACTAGGGCAAATCAGTCACAGCTGTGTGATCCTG
CTGAACGAGCTTCAAAATGCTCTGGAGAAATATAAACTCGTTGAATACAGTGGCACATCAATTCACAAAAAAGCT
AGAGGTATTTGGAAGAGGATTGTCTGGGAGCCGGAGGACATAAGTGAGCTCCGAGGTCGCCTAATGTCTAATGTG
ATATTGCTCCAGTCATTTTTGAGTGCTATATCAAGTCAAACGATGGCTGCGACAAAGCAAACACTGGAACAGCTC
AACTACAGACAAGAAGGCAATGAAAAGTCTTGCATTCTCGACTGGCTGTCTGCCGTGGATTACACGTTACAGCAG
AGTGATCTTCTCGGTCGACGACAAGGGGGAACTGGGAAATGGCTTCTCGATTCGCAAGAATATAAACATTGGCTT
CGAACACGCCGAGGCACCTTGTTTTGTCCCGGAATGCCGGGTGCGGGAAAGACCATCTGTTCTGCTATCCTTGTC
GATGATTTGACTACGCGCTTTGAGGATACCCCAGATGTCGGAATAGCTTACATTTATTGCAACTTCAATCGACAA
GATGAACAGACAGCTCAAGAGTTGCTTTCAAGTCTGTTGAAGCAATTAAGTCAGAAGAAGACATCTGTTCCGGAT
GCAGTCAAGGACCTATACAAGCGCTACAAAACTGCATCGACGCGTCCCCGATTCGATGAAATATCGAAAACTCTG
CATTCACTCGTTTCCACGTATTCCGATGTGTTTATTGTCATCGATGCCCTCGATGAGTGCGAATCCACTTGCCGT
ACCAGGGTTTTGGACGAGCTCAATAAACTTCGTGCCGGGCCTGGAGCAAATGTCTTCGCCACATCAAGACCTACA
GAAATTAATGATTTGTTTGAAGGGGGTTCCGTTCTGGAGATCCAGGCACAAGAAGACGACGTTAGACGGTACCTT
GCTGGGAATATGTTCCGACTCCCGGGGTTTGTAAGCCGAAATACTGCATTGCAAGAGGAGATTATGACTGCAATC
TCACGCCATGTACAGGGAATGTTTCTCCTTGCACAGCTTTATTTTGAGTCACTGATCGGTAGAAGGTCACCTAAA
TCTACTCGAACCGCTCTGAAAGAGTTTTCGAAGGGGTTTAATGACTATGCATACGACAAGGCCTATGACGACGCG
ATGAGCCGCATTCAAGGGCAACTGAGAGAGCAAACTGATTTGGCGATACAAACTCTATCTTGGCTCACATGCGCG
AGAAGGCCACTCACTTCATTGGAACTGCAGCATGCTCTTGCAATAGAAGAAGGAGAATCTAGTCTTGACGAGGAG
AACATTCCGGAGATTGAAGACATCCTTACTGTGTGCGCTGGTCTTGTTACCGTTGAAAATGAAAGCGGGATAATT
CGACTGGTCCATTATACAACGCAAGAATACCTCGAGCGGAAGAAAGATATGCTCTTTCCCAGCGCCGAAACTGAA
ATCAGCATGTTATGTGTCACTTACATCTCGTTCGACACGTTTGGGTCTGGGATTTGTGAAAGTGATGAAGCGTTT
GAGGAGCGTCTAGAATCACATCCATTCTACCGTTATGCGGTACGCCATTGGGGCGACCATGTGAGAACAACCAAA
GATCTGCATCCTGACGTGATAGAGTTTCTGAAAAACCAGTCGAAAGTTGAAGCTTCAGAACAAGCACTCCATGTC
AGGAGGCACTCAATCCCAAAAGATTGGAGCCAGAATTTTCCAAGGGAAAAGACGGGACTGCATCTCGCTGCAGAC
CGTGGAATTGAGGCAGCAGTATCCTACTTTCTTCAACACCAGCACTCCGTGGACGTACGTCATAACGGTGGCTGG
ACAGCATTGCAATATGCCATTTCAAGAGACCACCTGAATGTCGTCAAGTTACTTCTTTCCTGTGGAGCTGATGCA
AACGGAACAGGTCAGGATAATTTCACCAGCCCACTTTCACTTGCTGCCCAGTACGGACAAGAGGACATTGTCAGA
CTTCTTCTTGAGCGCGAAGTTGACGTTGATGGCCAGACTGGATGGTACCAAACCGCACTCATCGCAGCGTGTGAC
AAGGGCTATCTAAATATCGTTGAAACTCTCCTTAACAACAATGCAAATATCAATGCCGAAAGTGAGATACATGGT
ACACCCCTCGCTGCTGCGTCAGAGGCGGGTCACTGGAAAATTGTGACCTTCTTACTTGAGAAGGGGGCTACACCC
AGTTCTCAAGGGAACGAGGGTGAAACCGCTTTGGCATCAGCAGCATTACAGGGCCAGGAAGATATCGTACAAATC
TTGCTCGATCATCATGCGGATGTCAACCAACGAGAAGGAACTGCCCTCATAGCGGCTTGTCGCAGCGGGCATGAG
CAAGTGGTACGAATACTCCTGGCTAATGGTGCCGACCCGAATGCGGGAAACGGAGGACATAGCAGCGCACTGGTA
GCAGCTTCGATGAACGGAAATCAGCAAATAGTGCACATGCTCCTCGAGAGCGGTGCCAACATCAACGCGGAAAGT
TATCTCGGACCAGCACTAGTTGCTGCTGCAAAAACGGGGAACGACCACATAGTCAAGGTGCTACTCGAAAATGGT
GCTGAGATTCACGGCCGTGGCAAAGTCCAGGGATGCGCATTACATGCAGCTGCTTCCCGCGGAGATAGCCAGATA
GTGCAAATGCTCCTCGACAGAGGTGCCGACAGCACCATTCGTGCTGGTGTTTACAAAACGCCCCTGCGAGCAGCC
TTGATGGGAGGTCATCAGGAGGTTGCCGCGCTTCTCAAAAGACAGGGGCAGCAGTTGAGGGTCTGA
Gene >Pro_DTO377G3_2|g895.t1
ATGAGTTTTGGAGTGAGCATCGGGGACTTCATTTCGGTTCTTACTTTGGCTAATAAGCTCCGAAGAGACTTTGTT
GGCGCTCCGAGCCAGTTCAACAGTATCTCCAGAGAGTGCGTCGATATTGTACACCTAGGTTGTCGGCCAGTAACT
GATAATTTTGGTCTTACAGGGTCAGGGGGCTGGCAATTATTCTCCAGGATGTCGATGTTCAACTACTGGGCCATG
ATACCAATGATCAACAACAAAACCAACTAGGGCAAATCAGTCACAGCTGTGTGATCCTGCTGAACGAGCTTCAAA
ATGCTCTGGAGAAATATAAACTCGTTGAATACAGTGGCACATCAATTCACAAAAAAGCTAGAGGTATTTGGAAGA
GGATTGTCTGGGAGCCGGAGGACATAAGTGAGCTCCGAGGTCGCCTAATGTCTAATGTGATATTGCTCCAGTCAT
TTTTGAGTGCTATATCAAGGTATCATATATACTTCTCCCCTTCTGCCCCACCTGCCGCACCTAAGCATGACCAAC
ATCTGAAATCCATAGTCAAACGATGGCTGCGACAAAGCAAACACTGGAACAGCTCAACTACAGACAAGAAGGCAA
TGAAAAGTCTTGCATTCTCGACTGGCTGTCTGCCGTGGATTACACGTTACAGCAGAGTGATCTTCTCGGTCGACG
ACAAGGGGGAACTGGGAAATGGCTTCTCGATTCGCAAGAATATAAACATTGGCTTCGAACACGCCGAGGCACCTT
GTTTTGTCCCGGAATGCCGGGTGCGGGAAAGACCATCTGTTCTGCTATCCTTGTCGATGATTTGACTACGCGCTT
TGAGGATACCCCAGATGTCGGAATAGCTTACATTTATTGCAACTTCAATCGACAAGATGAACAGACAGCTCAAGA
GTTGCTTTCAAGTCTGTTGAAGCAATTAAGTCAGAAGAAGACATCTGTTCCGGATGCAGTCAAGGACCTATACAA
GCGCTACAAAACTGCATCGACGCGTCCCCGATTCGATGAAATATCGAAAACTCTGCATTCACTCGTTTCCACGTA
TTCCGATGTGTTTATTGTCATCGATGCCCTCGATGAGTGCGAATCCACTTGCCGTACCAGGGTTTTGGACGAGCT
CAATAAACTTCGTGCCGGGCCTGGAGCAAATGTCTTCGCCACATCAAGACCTACAGAAATTAATGATTTGTTTGA
AGGGGGTTCCGTTCTGGAGATCCAGGCACAAGAAGACGACGTTAGACGGTACCTTGCTGGGAATATGTTCCGACT
CCCGGGGTTTGTAAGCCGAAATACTGCATTGCAAGAGGAGATTATGACTGCAATCTCACGCCATGTACAGGGAAT
GTGAGTGCTCTTTATGAGATTGAATCTCCACAAAACACCTAGATTGCTCATTTACTTTCAGGTTTCTCCTTGCAC
AGCTTTATTTTGAGTCACTGATCGGTAGAAGGTCACCTAAATCTACTCGAACCGCTCTGAAAGAGTTTTCGAAGG
GGTTTAATGACTATGCATACGACAAGGCCTATGACGACGCGATGAGCCGCATTCAAGGGCAACTGAGAGAGCAAA
CTGATTTGGCGATACAAACTCTATCTTGGCTCACATGCGCGAGAAGGCCACTCACTTCATTGGAACTGCAGCATG
CTCTTGCAATAGAAGAAGGAGAATCTAGTCTTGACGAGGAGAACATTCCGGAGATTGAAGACATCCTTACTGTGT
GCGCTGGTCTTGTTACCGTTGAAAATGAAAGCGGGATAATTCGACTGGTCCATTATACAACGCAAGAATACCTCG
AGCGGAAGAAAGATATGCTCTTTCCCAGCGCCGAAACTGAAATCAGCATGTTATGTGTCACTTACATCTCGTTCG
ACACGTTTGGGTCTGGGATTTGTGAAAGTGATGAAGCGTTTGAGGAGCGTCTAGAATCACATCCATTCTACCGTT
ATGCGGTACGCCATTGGGGCGACCATGTGAGAACAACCAAAGATCTGCATCCTGACGTGATAGAGTTTCTGAAAA
ACCAGTCGAAAGTTGAAGCTTCAGAACAAGCACTCCATGTCAGGAGGCACTCAATCCCAAAAGATTGGAGCCAGA
ATTTTCCAAGGGAAAAGACGGGACTGCATCTCGCTGCAGACCGTGGAATTGAGGCAGCAGTATCCTACTTTCTTC
AACACCAGCACTCCGTGGACGTACGTCATAACGGTGGCTGGACAGCATTGCAATATGCCATTTCAAGAGACCACC
TGAATGTCGTCAAGTTACTTCTTTCCTGTGGAGCTGATGCAAACGGAACAGGTCAGGATAATTTCACCAGCCCAC
TTTCACTTGCTGCCCAGTACGGACAAGAGGACATTGTCAGACTTCTTCTTGAGCGCGAAGTTGACGTTGATGGCC
AGACTGGATGGTACCAAACCGCACTCATCGCAGCGTGTGACAAGGGCTATCTAAATATCGTTGAAACTCTCCTTA
ACAACAATGCAAATATCAATGCCGAAAGTGAGATACATGGTACACCCCTCGCTGCTGCGTCAGAGGCGGGTCACT
GGAAAATTGTGACCTTCTTACTTGAGAAGGGGGCTACACCCAGTTCTCAAGGGAACGAGGGTGAAACCGCTTTGG
CATCAGCAGCATTACAGGGCCAGGAAGATATCGTACAAATCTTGCTCGATCATCATGCGGATGTCAACCAACGAG
AAGGAACTGCCCTCATAGCGGCTTGTCGCAGCGGGCATGAGCAAGTGGTACGAATACTCCTGGCTAATGGTGCCG
ACCCGAATGCGGGAAACGGAGGACATAGCAGCGCACTGGTAGCAGCTTCGATGAACGGAAATCAGCAAATAGTGC
ACATGCTCCTCGAGAGCGGTGCCAACATCAACGCGGAAAGTTATCTCGGACCAGCACTAGTTGCTGCTGCAAAAA
CGGGGAACGACCACATAGTCAAGGTGCTACTCGAAAATGGTGCTGAGATTCACGGCCGTGGCAAAGTCCAGGGAT
GCGCATTACATGCAGCTGCTTCCCGCGGAGATAGCCAGATAGTGCAAATGCTCCTCGACAGAGGTGCCGACAGCA
CCATTCGTGCTGGTGTTTACAAAACGCCCCTGCGAGCAGCCTTGATGGGAGGTCATCAGGAGGTTGCCGCGCTTC
TCAAAAGACAGGGGCAGCAGTTGAGGGTCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail