Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g8927.t1
Gene name
Locationscaffold_39:14871..18350
Strand-
Gene length (bp)3479
Transcript length (bp)3360
Coding sequence length (bp)3360
Protein length (aa) 1120

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07819 PGAP1 PGAP1-like protein 1.3E-89 181 424
PF12697 Abhydrolase_6 Alpha/beta hydrolase family 4.9E-07 186 358

GO

GO Term Description Terminal node
GO:0016788 hydrolase activity, acting on ester bonds Yes
GO:0003824 catalytic activity No
GO:0003674 molecular_function No
GO:0016787 hydrolase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 46 0.45

Transmembrane Domains

Domain # Start End Length
1 100 122 22
2 763 782 19
3 863 885 22
4 931 953 22
5 982 1004 22
6 1019 1041 22
7 1048 1070 22
8 1074 1093 19

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g8927.t1
MHRRSSGSPVEDEDSSVSRTDDGNAIDEKTRSQIAQRGTSFDLRREGSATPRSRNSSMWRTPSFQPSNDTKSMPL
GSPRLPMEVPPSGGRRARQSRQRSPWSCSILTAFTTCAAVAILVCIVGSFTGRQHGGDGCGVPMMSPTFIRMLEF
DTEHTRFASKYNLFVYREEGVDPYTQDNIGLNGVPVLFLPGNAGSYRQVRSLAAEASRHYYDVVRHDESRHAAGT
RSLDFFMVDFNEDMAAFHGQTLLDQAEYVNEAISYILSLYHDPRRTRRDPGLPDPSAVILVGHSMGGIVARTALT
MANYQANSVNTIITMSAPHAKPPVSFDSDIVHTYKQINDYWRDAYAQTWANNNPLWHVTLISIAGGARDTVVPSD
YASISSLVPETHGFTVFTSSIPDVWIGMDHLSITWCDQFRKTIIKSLFEIVDARRPTQTKPRAERMRVLKRWYLT
GLEPVAERTLPQKEANTLLTLEDNANTILAQGQRLILRELGLQHGPDVRLLPIPPQGVSGKKFTLLTDQSLDKNG
NIEVLFCSVFPLSNGRSTNFPLNLDFSGGTVGSTRLACKSAAEDSIHLPASTRSSKHAYDRTPPFSYLQYDLEAL
AEHQFVAVVDKANVPTPGFLVAEFSDSSDAMIRAKVGLGGLLSAGLKMRLPANRPMLMEVKIPALYSSLLDYRLK
ITRHPQKEELFAPLLRQSVSDPHESKFFVNVNEVNVNLHGVAPYMPPAISEQAALGGVSFHLWTDPTSDSTVDIS
LQVDLTSSLGELVMRYRTIFAAFPLLVVALVLRKQFQVYDESGYFIPFTEGLDRALRSSFPLLLVAMSLLATSLA
TSKALPQTDETLHWRSNSTETPIDFTKNDLLLGSQDAFFWFLVPVFGLISVGVCVLVNYLALALVNIFSWGYGVV
HSKSGYIRREDRGNLPIFHTPTPRRRIIHTVILLILVSTVIPYQFAYMVACIVQLATCVRAQWHAKETRSTSHLN
FDNYAHSILILMLWILPINVLVLLVWAHNLVVHWFMPFSSHHNVLSIMPFLLLVETMTSGAMIPRITTRFRHVTS
MIFFAIAIYSAIYGVSYAYLLHHLANLLAAWLVGIYLFGNNFSPRRLWRIIDGDELPPETGSSHVKKKP*
Coding >Pro_DTO377G3_2|g8927.t1
ATGCACAGACGCTCGTCGGGCTCCCCTGTCGAGGACGAAGATTCCTCGGTCTCCCGAACAGACGATGGAAACGCC
ATCGACGAGAAAACCCGATCTCAGATAGCTCAGCGCGGCACCAGCTTTGACCTTCGCCGCGAGGGCAGCGCGACA
CCGCGCTCCCGGAACTCGAGTATGTGGCGCACCCCGTCCTTCCAACCCTCCAACGATACCAAATCGATGCCATTG
GGCTCCCCGCGACTTCCGATGGAAGTCCCCCCTTCCGGCGGCCGCCGTGCGCGACAATCTCGCCAACGCAGTCCA
TGGTCTTGCTCCATCCTGACGGCCTTCACCACTTGCGCTGCTGTCGCGATCTTAGTCTGCATCGTCGGCTCGTTC
ACCGGTCGGCAACATGGCGGAGACGGTTGCGGTGTTCCGATGATGAGCCCGACGTTCATTCGTATGTTGGAGTTT
GACACGGAACATACCCGCTTTGCAAGCAAATACAATCTCTTCGTCTATCGGGAAGAAGGCGTGGATCCTTACACC
CAGGATAACATCGGGTTGAACGGTGTCCCAGTTCTGTTTCTGCCCGGGAACGCTGGAAGCTACCGCCAAGTCCGA
TCTCTGGCCGCCGAGGCCTCGCGACATTACTACGATGTGGTCCGACACGACGAGAGCCGCCATGCGGCCGGAACG
CGGAGCTTGGACTTTTTCATGGTGGACTTCAACGAAGATATGGCGGCGTTCCATGGACAAACACTGTTGGATCAA
GCGGAATACGTGAACGAGGCGATCTCATACATCCTGTCACTTTACCATGATCCGCGACGCACCCGCCGAGACCCC
GGGTTACCGGATCCCAGCGCAGTAATCCTTGTTGGACACTCTATGGGGGGAATAGTGGCTCGAACTGCTTTGACC
ATGGCGAACTATCAAGCCAATTCGGTCAATACGATCATCACCATGTCTGCACCTCATGCGAAACCGCCTGTTTCC
TTCGATTCCGATATCGTCCACACCTATAAACAAATCAACGACTATTGGCGCGACGCCTATGCGCAGACTTGGGCG
AACAATAACCCACTCTGGCATGTCACTCTCATCTCCATCGCGGGTGGTGCGCGTGACACCGTGGTGCCCTCCGAC
TACGCCAGTATCTCCTCTCTCGTTCCTGAGACCCACGGATTTACCGTATTCACCTCTTCTATTCCGGATGTCTGG
ATTGGCATGGATCATCTGTCGATTACTTGGTGCGACCAGTTCCGCAAGACCATCATTAAATCCTTGTTCGAGATC
GTCGATGCCCGACGCCCTACTCAAACGAAACCACGGGCAGAACGGATGCGTGTGCTCAAGCGGTGGTACTTGACG
GGTCTGGAGCCAGTGGCCGAGCGTACACTGCCCCAGAAGGAGGCAAATACACTTCTGACACTTGAGGATAACGCA
AACACGATTCTTGCGCAGGGCCAGCGGCTGATCCTGCGTGAACTGGGCCTACAGCATGGCCCCGATGTTCGTCTT
TTACCGATTCCTCCGCAGGGCGTCTCTGGTAAAAAGTTCACCCTGCTCACGGACCAATCGCTTGATAAGAATGGC
AATATTGAGGTCCTATTCTGCAGCGTGTTCCCGCTATCCAATGGCCGTTCAACCAACTTCCCCTTGAATTTAGAT
TTCTCTGGTGGCACTGTGGGATCAACCCGTTTGGCCTGCAAGAGCGCGGCTGAGGACAGTATTCATTTGCCTGCC
TCGACCCGCTCATCTAAACATGCTTACGATCGTACCCCACCGTTTTCGTATCTCCAATACGACTTGGAGGCGCTC
GCAGAACATCAGTTTGTGGCTGTCGTAGACAAAGCCAATGTACCAACTCCAGGCTTCCTTGTCGCCGAGTTTTCG
GACAGCTCGGATGCAATGATTCGGGCTAAGGTTGGGTTAGGAGGGCTGCTCAGTGCTGGCCTAAAGATGCGGCTA
CCCGCCAACCGACCAATGCTCATGGAGGTTAAGATCCCGGCATTGTATTCGAGTCTGCTCGACTACCGGTTGAAG
ATCACTCGCCATCCTCAAAAGGAGGAACTGTTCGCTCCCTTGCTCCGTCAATCCGTCTCTGACCCTCATGAGTCG
AAGTTTTTCGTCAACGTCAATGAGGTCAATGTGAACCTGCACGGTGTGGCGCCGTACATGCCGCCTGCAATTAGT
GAGCAGGCCGCTCTCGGGGGCGTATCATTTCACCTGTGGACGGATCCAACCTCTGACTCGACGGTCGACATCTCC
CTCCAAGTTGATCTCACCAGCAGTCTTGGTGAGCTAGTGATGCGGTATCGGACCATATTCGCGGCTTTCCCACTG
CTCGTCGTTGCCCTCGTTCTCCGGAAGCAGTTCCAGGTCTACGATGAGTCTGGTTACTTTATTCCCTTCACCGAG
GGCCTTGATCGTGCGTTGCGGTCTTCCTTCCCGCTCCTGCTGGTAGCTATGTCTCTACTGGCCACCTCTCTGGCT
ACGTCCAAAGCCCTGCCCCAGACCGACGAAACCCTCCATTGGCGGTCCAACTCGACCGAGACTCCCATCGACTTC
ACCAAGAATGACCTATTGCTTGGCTCACAAGACGCTTTCTTCTGGTTCTTAGTCCCGGTATTCGGCCTCATTAGC
GTTGGTGTATGTGTCCTTGTTAACTATCTCGCCCTTGCCCTCGTGAACATCTTCTCCTGGGGTTATGGGGTCGTA
CACAGCAAGTCAGGCTACATCCGGCGAGAGGACCGGGGAAACCTGCCTATCTTCCACACTCCCACTCCTCGACGA
CGCATCATCCACACCGTCATCCTTTTGATCCTTGTCTCGACCGTCATCCCCTACCAGTTTGCCTATATGGTCGCC
TGCATTGTGCAGCTAGCCACATGTGTGCGGGCACAATGGCACGCCAAAGAAACCAGATCCACCTCGCACCTGAAC
TTCGACAACTATGCACACTCCATCTTAATCTTGATGTTGTGGATTCTGCCAATTAACGTGCTGGTCCTCCTGGTC
TGGGCCCACAATCTTGTCGTGCACTGGTTTATGCCGTTCTCATCCCACCACAACGTTTTATCTATTATGCCCTTC
CTCCTTCTCGTCGAGACCATGACCAGCGGCGCTATGATACCGCGCATCACGACCAGGTTCAGACACGTCACCTCA
ATGATCTTCTTCGCCATCGCTATCTACTCAGCAATCTATGGCGTCTCATATGCGTATCTTCTCCACCACCTCGCC
AATCTCCTCGCAGCCTGGCTCGTCGGAATTTACCTGTTTGGCAACAACTTCTCACCGCGCCGTCTGTGGCGTATC
ATCGATGGTGACGAGCTCCCACCTGAAACGGGGAGCAGCCACGTTAAGAAGAAGCCATGA
Transcript >Pro_DTO377G3_2|g8927.t1
ATGCACAGACGCTCGTCGGGCTCCCCTGTCGAGGACGAAGATTCCTCGGTCTCCCGAACAGACGATGGAAACGCC
ATCGACGAGAAAACCCGATCTCAGATAGCTCAGCGCGGCACCAGCTTTGACCTTCGCCGCGAGGGCAGCGCGACA
CCGCGCTCCCGGAACTCGAGTATGTGGCGCACCCCGTCCTTCCAACCCTCCAACGATACCAAATCGATGCCATTG
GGCTCCCCGCGACTTCCGATGGAAGTCCCCCCTTCCGGCGGCCGCCGTGCGCGACAATCTCGCCAACGCAGTCCA
TGGTCTTGCTCCATCCTGACGGCCTTCACCACTTGCGCTGCTGTCGCGATCTTAGTCTGCATCGTCGGCTCGTTC
ACCGGTCGGCAACATGGCGGAGACGGTTGCGGTGTTCCGATGATGAGCCCGACGTTCATTCGTATGTTGGAGTTT
GACACGGAACATACCCGCTTTGCAAGCAAATACAATCTCTTCGTCTATCGGGAAGAAGGCGTGGATCCTTACACC
CAGGATAACATCGGGTTGAACGGTGTCCCAGTTCTGTTTCTGCCCGGGAACGCTGGAAGCTACCGCCAAGTCCGA
TCTCTGGCCGCCGAGGCCTCGCGACATTACTACGATGTGGTCCGACACGACGAGAGCCGCCATGCGGCCGGAACG
CGGAGCTTGGACTTTTTCATGGTGGACTTCAACGAAGATATGGCGGCGTTCCATGGACAAACACTGTTGGATCAA
GCGGAATACGTGAACGAGGCGATCTCATACATCCTGTCACTTTACCATGATCCGCGACGCACCCGCCGAGACCCC
GGGTTACCGGATCCCAGCGCAGTAATCCTTGTTGGACACTCTATGGGGGGAATAGTGGCTCGAACTGCTTTGACC
ATGGCGAACTATCAAGCCAATTCGGTCAATACGATCATCACCATGTCTGCACCTCATGCGAAACCGCCTGTTTCC
TTCGATTCCGATATCGTCCACACCTATAAACAAATCAACGACTATTGGCGCGACGCCTATGCGCAGACTTGGGCG
AACAATAACCCACTCTGGCATGTCACTCTCATCTCCATCGCGGGTGGTGCGCGTGACACCGTGGTGCCCTCCGAC
TACGCCAGTATCTCCTCTCTCGTTCCTGAGACCCACGGATTTACCGTATTCACCTCTTCTATTCCGGATGTCTGG
ATTGGCATGGATCATCTGTCGATTACTTGGTGCGACCAGTTCCGCAAGACCATCATTAAATCCTTGTTCGAGATC
GTCGATGCCCGACGCCCTACTCAAACGAAACCACGGGCAGAACGGATGCGTGTGCTCAAGCGGTGGTACTTGACG
GGTCTGGAGCCAGTGGCCGAGCGTACACTGCCCCAGAAGGAGGCAAATACACTTCTGACACTTGAGGATAACGCA
AACACGATTCTTGCGCAGGGCCAGCGGCTGATCCTGCGTGAACTGGGCCTACAGCATGGCCCCGATGTTCGTCTT
TTACCGATTCCTCCGCAGGGCGTCTCTGGTAAAAAGTTCACCCTGCTCACGGACCAATCGCTTGATAAGAATGGC
AATATTGAGGTCCTATTCTGCAGCGTGTTCCCGCTATCCAATGGCCGTTCAACCAACTTCCCCTTGAATTTAGAT
TTCTCTGGTGGCACTGTGGGATCAACCCGTTTGGCCTGCAAGAGCGCGGCTGAGGACAGTATTCATTTGCCTGCC
TCGACCCGCTCATCTAAACATGCTTACGATCGTACCCCACCGTTTTCGTATCTCCAATACGACTTGGAGGCGCTC
GCAGAACATCAGTTTGTGGCTGTCGTAGACAAAGCCAATGTACCAACTCCAGGCTTCCTTGTCGCCGAGTTTTCG
GACAGCTCGGATGCAATGATTCGGGCTAAGGTTGGGTTAGGAGGGCTGCTCAGTGCTGGCCTAAAGATGCGGCTA
CCCGCCAACCGACCAATGCTCATGGAGGTTAAGATCCCGGCATTGTATTCGAGTCTGCTCGACTACCGGTTGAAG
ATCACTCGCCATCCTCAAAAGGAGGAACTGTTCGCTCCCTTGCTCCGTCAATCCGTCTCTGACCCTCATGAGTCG
AAGTTTTTCGTCAACGTCAATGAGGTCAATGTGAACCTGCACGGTGTGGCGCCGTACATGCCGCCTGCAATTAGT
GAGCAGGCCGCTCTCGGGGGCGTATCATTTCACCTGTGGACGGATCCAACCTCTGACTCGACGGTCGACATCTCC
CTCCAAGTTGATCTCACCAGCAGTCTTGGTGAGCTAGTGATGCGGTATCGGACCATATTCGCGGCTTTCCCACTG
CTCGTCGTTGCCCTCGTTCTCCGGAAGCAGTTCCAGGTCTACGATGAGTCTGGTTACTTTATTCCCTTCACCGAG
GGCCTTGATCGTGCGTTGCGGTCTTCCTTCCCGCTCCTGCTGGTAGCTATGTCTCTACTGGCCACCTCTCTGGCT
ACGTCCAAAGCCCTGCCCCAGACCGACGAAACCCTCCATTGGCGGTCCAACTCGACCGAGACTCCCATCGACTTC
ACCAAGAATGACCTATTGCTTGGCTCACAAGACGCTTTCTTCTGGTTCTTAGTCCCGGTATTCGGCCTCATTAGC
GTTGGTGTATGTGTCCTTGTTAACTATCTCGCCCTTGCCCTCGTGAACATCTTCTCCTGGGGTTATGGGGTCGTA
CACAGCAAGTCAGGCTACATCCGGCGAGAGGACCGGGGAAACCTGCCTATCTTCCACACTCCCACTCCTCGACGA
CGCATCATCCACACCGTCATCCTTTTGATCCTTGTCTCGACCGTCATCCCCTACCAGTTTGCCTATATGGTCGCC
TGCATTGTGCAGCTAGCCACATGTGTGCGGGCACAATGGCACGCCAAAGAAACCAGATCCACCTCGCACCTGAAC
TTCGACAACTATGCACACTCCATCTTAATCTTGATGTTGTGGATTCTGCCAATTAACGTGCTGGTCCTCCTGGTC
TGGGCCCACAATCTTGTCGTGCACTGGTTTATGCCGTTCTCATCCCACCACAACGTTTTATCTATTATGCCCTTC
CTCCTTCTCGTCGAGACCATGACCAGCGGCGCTATGATACCGCGCATCACGACCAGGTTCAGACACGTCACCTCA
ATGATCTTCTTCGCCATCGCTATCTACTCAGCAATCTATGGCGTCTCATATGCGTATCTTCTCCACCACCTCGCC
AATCTCCTCGCAGCCTGGCTCGTCGGAATTTACCTGTTTGGCAACAACTTCTCACCGCGCCGTCTGTGGCGTATC
ATCGATGGTGACGAGCTCCCACCTGAAACGGGGAGCAGCCACGTTAAGAAGAAGCCATGA
Gene >Pro_DTO377G3_2|g8927.t1
ATGCACAGACGCTCGTCGGGCTCCCCTGTCGAGGACGAAGATTCCTCGGTCTCCCGAACAGACGATGGAAACGCC
ATCGACGAGAAAACCCGATCTCAGATAGCTCAGCGCGGCACCAGCTTTGACCTTCGCCGCGAGGGCAGCGCGACA
CCGCGCTCCCGGAACTCGAGTATGTGGCGCACCCCGTCCTTCCAACCCTCCAACGATACCAAATCGATGCCATTG
GGCTCCCCGCGACTTCCGATGGAAGTCCCCCCTTCCGGCGGCCGCCGTGCGCGACAATCTCGCCAACGCAGTCCA
TGGTCTTGCTCCATCCTGACGGCCTTCACCACTTGCGCTGCTGTCGCGATCTTAGTCTGCATCGTCGGCTCGTTC
ACCGGTCGGCAACATGGCGGAGACGGTTGCGGTGTTCCGATGATGAGCCCGACGTTCATTCGTATGTTGGAGTTT
GACACGGAACATACCCGCTTTGCAAGCAAATACAATCTCTTCGTCTATCGGGAAGAAGGCGTGGATCCTTACACC
CAGGATAACATCGGGGTACGGCGACCCGGACTCGGTGCATGCGCTTGGATTCTTACTGACTCTGTGTTTAGTTGA
ACGGTGTCCCAGTTCTGTTTCTGCCCGGGAACGCTGGAAGCTACCGCCAAGTCCGATCTCTGGCCGCCGAGGCCT
CGCGACATTACTACGATGTGGTCCGACACGACGAGAGCCGCCATGCGGCCGGAACGCGGAGCTTGGACTTTTTCA
TGGTGGACTTCAACGAAGATATGGCGGCGTTCCATGGACAAACACTGTTGGATCAAGCGGAATACGTGAACGAGG
CGATCTCATACATCCTGTCACTTTACCATGATCCGCGACGCACCCGCCGAGACCCCGGGTTACCGGATCCCAGCG
CAGTAATCCTTGTTGGACACTCTATGGGGGGAATAGTGGCTCGAACTGCTTTGACCATGGCGAACTATCAAGCCA
ATTCGGTCAATACGATCATCACCATGTCTGCACCTCATGCGAAACCGCCTGTTTCCTTCGATTCCGATATCGTCC
ACACCTATAAACAAATCAACGACTATTGGCGCGACGCCTATGCGCAGACTTGGGCGAACAATAACCCACTCTGGC
ATGTCACTCTCATCTCCATCGCGGGTGGTGCGCGTGACACCGTGGTGCCCTCCGACTACGCCAGTATCTCCTCTC
TCGTTCCTGAGACCCACGGATTTACCGTATTCACCTCTTCTATTCCGGATGTCTGGATTGGCATGGATCATCTGT
CGATTACTTGGTGCGACCAGTTCCGCAAGACCATCATTAAATCCTTGTTCGAGATCGTCGATGCCCGACGCCCTA
CTCAAACGAAACCACGGGCAGAACGGATGCGTGTGCTCAAGCGGTGGTACTTGACGGGTCTGGAGCCAGTGGCCG
AGCGTACACTGCCCCAGAAGGAGGCAAATACACTTCTGACACTTGAGGATAACGCAAACACGATTCTTGCGCAGG
GCCAGCGGCTGATCCTGCGTGAACTGGGCCTACAGCATGGCCCCGATGTTCGTCTTTTACCGATTCCTCCGCAGG
GCGTCTCTGGTAAAAAGTTCACCCTGCTCACGGACCAATCGCTTGATAAGAATGGCAATATTGAGGTCCTATTCT
GCAGCGTGTTCCCGCTATCCAATGGCCGTTCAACCAACTTCCCCTTGAATTTAGATTTCTCTGGTGGCACTGTGG
GATCAACCCGTTTGGCCTGCAAGAGCGCGGCTGAGGACAGTATTCATTTGCCTGCCTCGACCCGCTCATCTAAAC
ATGCTTACGATCGTACCCCACCGTTTTCGTATCTCCAATACGACTTGGAGGCGCTCGCAGAACATCAGTTTGTGG
CTGTCGTAGACAAAGCCAATGTACCAACTCCAGGCTTCCTTGTCGCCGAGTTTTCGGACAGCTCGGATGCAATGA
TTCGGGCTAAGGTTGGGTTAGGAGGGCTGCTCAGTGCTGGCCTAAAGATGCGGCTACCCGCCAACCGACCAATGC
TCATGGAGGTTAAGATCCCGGCATTGTATTCGAGTCTGCTCGACTACCGGTTGAAGATCACTCGCCATCCTCAAA
AGGAGGAACTGTTCGCTCCCTTGCTCCGTCAATCCGTCTCTGACCCTCATGAGTCGAAGTTTTTCGTCAACGTCA
ATGAGGTCAATGTGAACCTGCACGGTGTGGCGCCGTACATGCCGCCTGCAATTAGTGAGCAGGCCGCTCTCGGGG
GCGTATCATTTCACCTGTGGACGGATCCAACCTCTGACTCGACGGTCGACATCTCCCTCCAAGTTGATCTCACCA
GCAGTCTTGGTGAGCTAGTGATGCGGTATCGGACCATATTCGCGGCTTTCCCACTGCTCGTCGTTGCCCTCGTTC
TCCGGAAGCAGTTCCAGGTCTACGATGAGTCTGGTTACTTTATTCCCTTCACCGAGGGCCTTGATCGTGCGTTGC
GGTCTTCCTTCCCGCTCCTGCTGGTAGCTATGTCTCTACTGGCCACCTCTCTGGCTACGTCCAAAGCCCTGCCCC
AGACCGACGAAACCCTCCATTGGCGGTCCAACTCGACCGAGACTCCCATCGACTTCACCAAGAATGACCTATTGC
TTGGCTCACAAGACGCTTTCTTCTGGTTCTTAGTCCCGGTATTCGGCCTCATTAGCGTTGGTGTATGTGTCCTTG
TTAACTATCTCGCCCTTGCCCTCGTGAACATCTTCTCCTGGGGTTATGGGGTCGTACACAGCAAGTCAGGCTACA
TCCGGCGAGAGGACCGGGGAAACCTGCCTATCTTCCACACTCCCACTCCTCGACGACGCATCATCCACACCGTCA
TCCTTTTGATCCTTGTCTCGACCGTCATCCCCTACCAGTTTGCCTATATGGTCGCCTGCATTGTGCAGCTAGCCA
CATGTGTGCGGGCACAATGGCACGCCAAAGAAACCAGATCCACCTCGCACCTGAACTTCGACAACTATGCACACT
CCATCTTAATCTTGATGTTGTGGATTCTGCCAATTAACGTGCTGGTCCTCCTGGTCTGGGCCCACAATCTTGTCG
TGCACTGGTTTATGCCGTTCTCATCCCACCACAACGTTTTATCTATTATGCCCTTCCTCCTTCTCGTCGAGACCA
TGACCAGCGGCGCTATGATACCGCGCATCACGACCAGGTATGTAGACTCTAGAGTGTTACATCTCACAAGTTCCA
ACTAACATATCCATCTCCGCTATAGGTTCAGACACGTCACCTCAATGATCTTCTTCGCCATCGCTATCTACTCAG
CAATCTATGGCGTCTCATATGCGTATCTTCTCCACCACCTCGCCAATCTCCTCGCAGCCTGGCTCGTCGGAATTT
ACCTGTTTGGCAACAACTTCTCACCGCGCCGTCTGTGGCGTATCATCGATGGTGACGAGCTCCCACCTGAAACGG
GGAGCAGCCACGTTAAGAAGAAGCCATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail