Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g8925.t1
Gene name
Locationscaffold_39:5289..8555
Strand-
Gene length (bp)3266
Transcript length (bp)3201
Coding sequence length (bp)3201
Protein length (aa) 1067

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00005 ABC_tran ABC transporter 4.8E-19 463 595
PF00005 ABC_tran ABC transporter 1.5E-23 708 948
PF17947 4HB Four helical bundle domain 1.8E-29 351 428

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0043167 ion binding No
GO:0036094 small molecule binding No
GO:0030554 adenyl nucleotide binding No
GO:0003674 molecular_function No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0032559 adenyl ribonucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:0043168 anion binding No
GO:0000166 nucleotide binding No
GO:0005488 binding No
GO:0097159 organic cyclic compound binding No
GO:0032553 ribonucleotide binding No
GO:1901265 nucleoside phosphate binding No
GO:0032555 purine ribonucleotide binding No
GO:0017076 purine nucleotide binding No
GO:0097367 carbohydrate derivative binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 18 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 217.22 122.95 311.49
5d_25C Five days - 25 degrees Celsius 268.08 148.52 387.65
7d_25C Seven days - 25 degrees Celsius 306.04 167.23 444.86
10d_25C Ten days - 25 degrees Celsius 373.97 199.75 548.19
7d_15C Seven days - 15 degrees Celsius 247.30 138.04 356.56
7d_30C Seven days - 30 degrees Celsius 302.99 165.49 440.49

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.441053 no
3d_25C 7d_25C 0.167227 no
3d_25C 7d_15C 0.670787 no
3d_25C 7d_30C 0.182527 no
3d_25C 10d_25C 0.021163 yes
5d_25C 7d_25C 0.674658 no
5d_25C 7d_15C 0.813288 no
5d_25C 7d_30C 0.702015 no
5d_25C 10d_25C 0.196395 no
7d_25C 7d_15C 0.456717 no
7d_25C 7d_30C 0.981054 no
7d_25C 10d_25C 0.503973 no
7d_15C 7d_30C 0.482338 no
7d_15C 10d_25C 0.099307 no
7d_30C 10d_25C 0.478653 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g8925.t1
MPAASDATPAATGKASAQSVAVLEDLIKNLNISTSADETNAAATNLATLFSGPIAEQTLPLKATEIFKKQLANKK
DATARERACEGIRAIAAHPTIAPGVEPHLVALLGPVLAAVGDKVVAVKQAAQSTAIAIVQAVSGNAVKAVITPIL
YSLANAQKWPEKMAALDCINILVESAQMQLGYQVPTLIPVISEAMWDTKAEIKKAAYSTMEKVCGLIVNKDIERF
IPELIKCIAKPENVAETVHLLGATTFVTDVTGPTLAIMVPLLDRGLVERETAIKRKTAVIVDNMCKLVEDPQLVA
PFLPKMLPGLNKNFETLADPEAREKTRQALDTLSRVGNVVDGKIPEVSRAGDISTIVAILKEILEAKHKDVIAHS
EEAITYVAAIAAQLVDEKENDHVIWTQNTMPYITAIVGEENAKSIAEELRKKACPDAAAADAIASDEEEGVDLCN
CTFSLAYGAKILLNQTHLRLKRGQRYGLLGPNGSGKTTLMRAINNEQLEGFPKKDEVKTVYVEHDLDSADTEQTV
IAWTQKKLAEVGQNPPREELEGKLLNEFGFSEFQIQGPITALSGGWKMKLALCRAVFENPDILLLDEPTNHLDVK
NVAWLEEYLKNSPCTSIMVSHDSKFLDNVIQHVVHYERFKLRRYRGTLSEFVKQHPAARSYYELGASEMEFKFPE
PGFLEGVKTKSKAICRVSNMSFQYPGTPKPQIHGITFQVSLGSRIAVIGANGAGKSTLVNVLTGELIPTSGEVYQ
HENIRIAYIKQHAFAHIDNHLNSTPSEYIQWRFQTGEDRETMDRANKIVTEEDEKAMDKIYKIEGTLRRVIGIHS
RRKFKNTYEYEISWSLGDNVGMKSEKWTPLMSADNTWLPRSEIIVSHPKQVAEVDQKEALASGQFRPLVRKEIEQ
HCANFGLDAELVSHSRMRGLSGGQRVKVVLAACSWQRPHLIVLDEPTNYLDRDSLGALSKAIKSFEGGVVIITHS
REFTEHLTEEVWAVNDGVMTPSGHNWVQGQGSGPRLDAKGDDDEDKFDAMGNKIVVTKKVKLTGSELRKKKKDRA
ARRKRGEEVFSDEDDL*
Coding >Pro_DTO377G3_2|g8925.t1
ATGCCCGCCGCCTCCGACGCTACTCCTGCCGCCACTGGCAAGGCGTCCGCCCAGTCGGTCGCTGTCCTCGAGGAC
CTCATCAAGAACCTCAACATCTCCACCAGCGCCGACGAAACCAACGCCGCTGCTACTAACCTTGCCACTCTCTTC
AGCGGTCCTATCGCCGAGCAGACTCTTCCTCTGAAGGCCACCGAGATCTTCAAGAAGCAGCTCGCCAACAAGAAG
GATGCTACTGCCCGTGAGCGTGCCTGCGAGGGTATCCGTGCTATTGCCGCCCACCCCACAATCGCTCCCGGTGTT
GAGCCTCACCTCGTGGCTCTCCTCGGCCCTGTCCTCGCCGCTGTTGGTGACAAGGTTGTCGCCGTCAAGCAGGCC
GCCCAGTCCACCGCTATCGCCATTGTCCAGGCTGTCAGCGGTAACGCCGTCAAGGCCGTTATCACCCCTATCCTC
TACTCCCTCGCCAACGCCCAGAAGTGGCCCGAAAAGATGGCTGCTCTCGACTGCATCAACATCCTCGTTGAGTCT
GCCCAGATGCAGCTTGGCTACCAGGTTCCCACTCTGATCCCCGTCATCTCCGAGGCTATGTGGGACACCAAGGCC
GAGATCAAGAAGGCTGCCTACTCCACCATGGAGAAGGTTTGCGGTCTGATCGTCAACAAGGATATTGAGCGTTTC
ATTCCCGAGCTGATCAAGTGTATCGCCAAGCCCGAGAACGTCGCCGAGACCGTTCACTTGCTCGGTGCCACTACT
TTCGTCACTGATGTCACTGGCCCTACCCTCGCTATCATGGTCCCCCTGCTTGACCGTGGTCTCGTCGAGCGTGAG
ACCGCCATCAAGCGTAAGACCGCTGTCATTGTCGACAACATGTGTAAGCTCGTGGAGGACCCCCAGCTTGTCGCT
CCCTTCTTGCCTAAGATGTTGCCCGGTTTGAACAAGAACTTCGAGACTCTTGCCGACCCCGAGGCCCGTGAGAAG
ACTCGCCAGGCTCTTGACACCCTTTCCCGTGTTGGTAACGTTGTGGACGGCAAGATTCCCGAGGTTTCCCGCGCT
GGTGACATTTCCACCATCGTTGCCATCCTCAAGGAGATCCTCGAGGCTAAGCACAAGGACGTCATTGCCCATTCC
GAGGAGGCCATCACCTACGTTGCTGCCATCGCCGCTCAGCTTGTTGACGAGAAGGAGAACGACCACGTCATCTGG
ACCCAGAACACCATGCCTTACATCACTGCCATCGTCGGTGAGGAGAATGCTAAGTCCATCGCTGAGGAGCTCCGC
AAGAAGGCTTGCCCCGATGCCGCCGCCGCTGATGCCATCGCCTCCGATGAGGAGGAAGGTGTCGATCTTTGCAAC
TGCACTTTCTCCCTGGCTTACGGTGCCAAGATTCTGCTTAACCAGACTCACCTGCGCCTGAAGCGTGGCCAGCGT
TACGGTCTCCTCGGCCCCAACGGTTCCGGAAAGACCACCCTCATGCGTGCCATCAACAACGAGCAGCTCGAGGGT
TTCCCCAAGAAGGATGAGGTCAAGACCGTCTACGTCGAGCACGATCTCGACTCTGCCGATACTGAGCAGACCGTC
ATTGCCTGGACCCAGAAGAAGCTTGCTGAGGTTGGACAGAACCCTCCCCGTGAGGAGCTCGAGGGCAAGCTGCTC
AACGAATTCGGTTTCTCCGAGTTCCAGATTCAGGGTCCCATTACTGCCCTCTCTGGTGGTTGGAAGATGAAGCTC
GCTCTCTGCCGTGCTGTCTTCGAGAACCCCGATATTCTCTTGCTTGACGAGCCTACCAACCACTTGGACGTCAAG
AACGTCGCATGGCTCGAGGAGTACCTGAAGAACTCCCCCTGCACTTCTATCATGGTTTCTCACGACTCCAAGTTC
CTCGACAACGTCATCCAGCACGTCGTTCACTACGAGCGCTTCAAGCTCCGCCGTTACCGTGGTACCCTCTCCGAG
TTCGTCAAGCAGCACCCCGCTGCTCGGTCCTACTACGAGCTCGGTGCCTCCGAGATGGAGTTCAAGTTCCCCGAG
CCCGGTTTCCTTGAGGGTGTTAAGACCAAGTCCAAGGCCATTTGCCGTGTTAGCAACATGTCCTTCCAGTACCCC
GGTACCCCCAAGCCCCAGATTCACGGAATTACCTTCCAGGTCTCCCTTGGATCCCGTATTGCCGTCATCGGTGCC
AACGGTGCTGGCAAGTCTACTCTCGTTAACGTCCTGACTGGTGAACTCATTCCCACCTCCGGTGAGGTCTACCAG
CACGAGAACATCCGTATTGCCTACATTAAGCAGCACGCTTTCGCTCACATCGATAACCACCTCAACTCCACTCCT
TCCGAGTACATCCAGTGGCGTTTCCAGACCGGTGAGGACCGCGAGACCATGGACCGTGCCAACAAGATCGTCACC
GAGGAGGATGAGAAGGCCATGGACAAGATCTACAAGATTGAAGGCACCCTCCGCCGTGTCATCGGTATCCACTCT
CGTCGCAAGTTCAAGAACACCTACGAGTACGAGATCTCTTGGTCTCTGGGTGACAACGTCGGCATGAAGTCCGAG
AAGTGGACTCCTCTCATGTCCGCTGACAACACCTGGTTGCCTCGCTCCGAGATTATTGTCTCTCACCCCAAGCAG
GTCGCTGAGGTTGATCAGAAGGAGGCCCTCGCCTCCGGTCAGTTCCGTCCCCTTGTCCGCAAGGAGATCGAGCAG
CACTGCGCCAACTTTGGTCTCGATGCCGAGCTTGTTTCTCACTCTCGCATGCGCGGTCTCTCCGGTGGCCAGCGT
GTTAAGGTCGTTCTCGCCGCTTGCTCGTGGCAGCGTCCTCACCTTATCGTCCTTGACGAGCCCACTAACTACCTC
GACCGTGACTCCCTCGGTGCCCTCTCCAAGGCTATCAAGTCTTTCGAGGGTGGTGTTGTTATCATTACTCACTCC
CGTGAGTTCACTGAGCACCTGACTGAGGAAGTCTGGGCCGTCAACGACGGTGTCATGACCCCCTCCGGACACAAT
TGGGTCCAGGGTCAGGGCTCTGGCCCCCGTCTCGACGCCAAGGGTGACGATGATGAGGACAAGTTCGATGCCATG
GGCAACAAGATCGTTGTTACAAAGAAGGTCAAGCTTACTGGCTCTGAGCTTCGCAAGAAGAAGAAGGATCGTGCT
GCCCGCCGCAAGCGTGGTGAGGAGGTGTTCTCCGATGAGGATGACCTTTGA
Transcript >Pro_DTO377G3_2|g8925.t1
ATGCCCGCCGCCTCCGACGCTACTCCTGCCGCCACTGGCAAGGCGTCCGCCCAGTCGGTCGCTGTCCTCGAGGAC
CTCATCAAGAACCTCAACATCTCCACCAGCGCCGACGAAACCAACGCCGCTGCTACTAACCTTGCCACTCTCTTC
AGCGGTCCTATCGCCGAGCAGACTCTTCCTCTGAAGGCCACCGAGATCTTCAAGAAGCAGCTCGCCAACAAGAAG
GATGCTACTGCCCGTGAGCGTGCCTGCGAGGGTATCCGTGCTATTGCCGCCCACCCCACAATCGCTCCCGGTGTT
GAGCCTCACCTCGTGGCTCTCCTCGGCCCTGTCCTCGCCGCTGTTGGTGACAAGGTTGTCGCCGTCAAGCAGGCC
GCCCAGTCCACCGCTATCGCCATTGTCCAGGCTGTCAGCGGTAACGCCGTCAAGGCCGTTATCACCCCTATCCTC
TACTCCCTCGCCAACGCCCAGAAGTGGCCCGAAAAGATGGCTGCTCTCGACTGCATCAACATCCTCGTTGAGTCT
GCCCAGATGCAGCTTGGCTACCAGGTTCCCACTCTGATCCCCGTCATCTCCGAGGCTATGTGGGACACCAAGGCC
GAGATCAAGAAGGCTGCCTACTCCACCATGGAGAAGGTTTGCGGTCTGATCGTCAACAAGGATATTGAGCGTTTC
ATTCCCGAGCTGATCAAGTGTATCGCCAAGCCCGAGAACGTCGCCGAGACCGTTCACTTGCTCGGTGCCACTACT
TTCGTCACTGATGTCACTGGCCCTACCCTCGCTATCATGGTCCCCCTGCTTGACCGTGGTCTCGTCGAGCGTGAG
ACCGCCATCAAGCGTAAGACCGCTGTCATTGTCGACAACATGTGTAAGCTCGTGGAGGACCCCCAGCTTGTCGCT
CCCTTCTTGCCTAAGATGTTGCCCGGTTTGAACAAGAACTTCGAGACTCTTGCCGACCCCGAGGCCCGTGAGAAG
ACTCGCCAGGCTCTTGACACCCTTTCCCGTGTTGGTAACGTTGTGGACGGCAAGATTCCCGAGGTTTCCCGCGCT
GGTGACATTTCCACCATCGTTGCCATCCTCAAGGAGATCCTCGAGGCTAAGCACAAGGACGTCATTGCCCATTCC
GAGGAGGCCATCACCTACGTTGCTGCCATCGCCGCTCAGCTTGTTGACGAGAAGGAGAACGACCACGTCATCTGG
ACCCAGAACACCATGCCTTACATCACTGCCATCGTCGGTGAGGAGAATGCTAAGTCCATCGCTGAGGAGCTCCGC
AAGAAGGCTTGCCCCGATGCCGCCGCCGCTGATGCCATCGCCTCCGATGAGGAGGAAGGTGTCGATCTTTGCAAC
TGCACTTTCTCCCTGGCTTACGGTGCCAAGATTCTGCTTAACCAGACTCACCTGCGCCTGAAGCGTGGCCAGCGT
TACGGTCTCCTCGGCCCCAACGGTTCCGGAAAGACCACCCTCATGCGTGCCATCAACAACGAGCAGCTCGAGGGT
TTCCCCAAGAAGGATGAGGTCAAGACCGTCTACGTCGAGCACGATCTCGACTCTGCCGATACTGAGCAGACCGTC
ATTGCCTGGACCCAGAAGAAGCTTGCTGAGGTTGGACAGAACCCTCCCCGTGAGGAGCTCGAGGGCAAGCTGCTC
AACGAATTCGGTTTCTCCGAGTTCCAGATTCAGGGTCCCATTACTGCCCTCTCTGGTGGTTGGAAGATGAAGCTC
GCTCTCTGCCGTGCTGTCTTCGAGAACCCCGATATTCTCTTGCTTGACGAGCCTACCAACCACTTGGACGTCAAG
AACGTCGCATGGCTCGAGGAGTACCTGAAGAACTCCCCCTGCACTTCTATCATGGTTTCTCACGACTCCAAGTTC
CTCGACAACGTCATCCAGCACGTCGTTCACTACGAGCGCTTCAAGCTCCGCCGTTACCGTGGTACCCTCTCCGAG
TTCGTCAAGCAGCACCCCGCTGCTCGGTCCTACTACGAGCTCGGTGCCTCCGAGATGGAGTTCAAGTTCCCCGAG
CCCGGTTTCCTTGAGGGTGTTAAGACCAAGTCCAAGGCCATTTGCCGTGTTAGCAACATGTCCTTCCAGTACCCC
GGTACCCCCAAGCCCCAGATTCACGGAATTACCTTCCAGGTCTCCCTTGGATCCCGTATTGCCGTCATCGGTGCC
AACGGTGCTGGCAAGTCTACTCTCGTTAACGTCCTGACTGGTGAACTCATTCCCACCTCCGGTGAGGTCTACCAG
CACGAGAACATCCGTATTGCCTACATTAAGCAGCACGCTTTCGCTCACATCGATAACCACCTCAACTCCACTCCT
TCCGAGTACATCCAGTGGCGTTTCCAGACCGGTGAGGACCGCGAGACCATGGACCGTGCCAACAAGATCGTCACC
GAGGAGGATGAGAAGGCCATGGACAAGATCTACAAGATTGAAGGCACCCTCCGCCGTGTCATCGGTATCCACTCT
CGTCGCAAGTTCAAGAACACCTACGAGTACGAGATCTCTTGGTCTCTGGGTGACAACGTCGGCATGAAGTCCGAG
AAGTGGACTCCTCTCATGTCCGCTGACAACACCTGGTTGCCTCGCTCCGAGATTATTGTCTCTCACCCCAAGCAG
GTCGCTGAGGTTGATCAGAAGGAGGCCCTCGCCTCCGGTCAGTTCCGTCCCCTTGTCCGCAAGGAGATCGAGCAG
CACTGCGCCAACTTTGGTCTCGATGCCGAGCTTGTTTCTCACTCTCGCATGCGCGGTCTCTCCGGTGGCCAGCGT
GTTAAGGTCGTTCTCGCCGCTTGCTCGTGGCAGCGTCCTCACCTTATCGTCCTTGACGAGCCCACTAACTACCTC
GACCGTGACTCCCTCGGTGCCCTCTCCAAGGCTATCAAGTCTTTCGAGGGTGGTGTTGTTATCATTACTCACTCC
CGTGAGTTCACTGAGCACCTGACTGAGGAAGTCTGGGCCGTCAACGACGGTGTCATGACCCCCTCCGGACACAAT
TGGGTCCAGGGTCAGGGCTCTGGCCCCCGTCTCGACGCCAAGGGTGACGATGATGAGGACAAGTTCGATGCCATG
GGCAACAAGATCGTTGTTACAAAGAAGGTCAAGCTTACTGGCTCTGAGCTTCGCAAGAAGAAGAAGGATCGTGCT
GCCCGCCGCAAGCGTGGTGAGGAGGTGTTCTCCGATGAGGATGACCTTTGA
Gene >Pro_DTO377G3_2|g8925.t1
ATGCCCGCCGCCTCCGACGCTACTCCTGCCGCCACTGGCAAGGCGTCCGCCCAGTCGGTCGCTGTCCTCGAGGAC
CTCATCAAGAACCTCAACATCTCCACCAGCGCCGACGAAACCAACGCCGCTGCTACTAACCTTGCCACTCTCTTC
AGCGGTCCTATCGCCGAGCAGACTCTTCCTCTGAAGGCCACCGAGATCTTCAAGAAGCAGCTCGCCAACAAGAAG
GATGCTACTGCCCGTGAGCGTGCCTGCGAGGGTATCCGTGCTATTGCCGCCCACCCCACAATCGCTCCCGGTGTT
GAGCCTCACCTCGTGGCTCTCCTCGGCCCTGTCCTCGCCGCTGTTGGTGACAAGGTTGTCGCCGTCAAGCAGGCC
GCCCAGTCCACCGCTATCGCCATTGTCCAGGCTGTCAGCGGTAACGCCGTCAAGGCCGTTATCACCCCTATCCTC
TACTCCCTCGCCAACGCCCAGAAGTGGCCCGAAAAGATGGCTGCTCTCGACTGCATCAACATCCTCGTTGAGTCT
GCCCAGATGCAGCTTGGCTACCAGGTTCCCACTCTGATCCCCGTCATCTCCGAGGCTATGTGGGACACCAAGGCC
GAGATCAAGAAGGCTGCCTACTCCACCATGGAGAAGGTTTGCGGTCTGATCGTCAACAAGGATATTGAGCGTTTC
ATTCCCGAGCTGATCAAGTGTATCGCCAAGCCCGAGAACGTCGCCGAGACCGTTCACTTGCTCGGTGCCACTACT
TTCGTCACTGATGTCACTGGCCCTACCCTCGCTATCATGGTCCCCCTGCTTGACCGTGGTCTCGTCGAGCGTGAG
ACCGCCATCAAGCGTAAGACCGCTGTCATTGTCGACAACATGTGTAAGCTCGTGGAGGACCCCCAGCTTGTCGCT
CCCTTCTTGCCTAAGATGTTGCCCGGTTTGAACAAGAACTTCGAGACTCTTGCCGACCCCGAGGCCCGTGAGAAG
ACTCGCCAGGCTCTTGACACCCTTTCCCGTGTTGGTAACGTTGTGGACGGCAAGATTCCCGAGGTTTCCCGCGCT
GGTGACATTTCCACCATCGTTGCCATCCTCAAGGAGATCCTCGAGGCTAAGCACAAGGACGTCATTGCCCATTCC
GAGGAGGCCATCACCTACGTTGCTGCCATCGCCGCTCAGCTTGTTGACGAGAAGGAGAACGACCACGTCATCTGG
ACCCAGAACACCATGCCTTACATCACTGCCATCGTCGGTGAGGAGAATGCTAAGTCCATCGCTGAGGAGCTCCGC
AAGAAGGCTTGCCCCGATGCCGCCGCCGCTGATGCCATCGCCTCCGATGAGGAGGAAGGTGTCGATCTTTGCAAC
TGCACTTTCTCCCTGGCTTACGGTGCCAAGATTCTGCTTAACCAGACTCACCTGCGCCTGAAGCGTGGCCAGCGT
TACGGTCTCCTCGGCCCCAACGGTTCCGGAAAGACCACCCTCATGCGTGCCATCAACAACGAGCAGCTCGAGGGT
TTCCCCAAGAAGGATGAGGTCAAGACCGTCTACGTCGAGCACGATCTCGACTCTGCCGATACTGAGCAGACCGTC
ATTGCCTGGACCCAGAAGAAGCTTGCTGAGGTTGGACAGAACCCTCCCCGTGAGGAGCTCGAGGGCAAGCTGCTC
AACGAATTCGGTTTCTCCGAGTTCCAGATTCAGGGTCCCATTACTGCCCTCTCTGGTGGTTGGAAGATGAAGCTC
GCTCTCTGCCGTGCTGTCTTCGAGAACCCCGATATTCTCTTGCTTGACGAGCCTACCAACCACTTGGACGTCAAG
AACGTCGCATGGCTCGAGGAGTACCTGAAGAACTCCCCCTGCACTTCTATCATGGTTTCTCACGACTCCAAGTTC
CTCGACAACGTCATCCAGCACGTCGTTCACTACGAGCGCTTCAAGCTCCGCCGTTACCGTGGTACCCTCTCCGAG
TTCGTCAAGCAGCACCCCGCTGCTCGGTCCTACTACGAGCTCGGTGCCTCCGAGATGGAGTTCAAGTTCCCCGAG
CCCGGTTTCCTTGAGGGTGTTAAGACCAAGTCCAAGGCCATTTGCCGTGTTAGCAACATGTCCTTCCAGTACCCC
GGTACCCCCAAGCCCCAGATTCACGGAATTACCTTCCAGGTCTCCCTTGGATCCCGTATTGCCGTCATCGGTGCC
AACGGTGCTGGCAAGTCTACTCTCGTTAACGTCCTGACTGGTGAACTCATTCCCACCTCCGGTGAGGTCTACCAG
CACGAGAACATCCGTATTGCCTACATTAAGCAGCACGCTTTCGCTCACATCGATAACCACCTCAACTCCACTCCT
TCCGAGTACATCCAGTGGCGTTTCCAGACCGGTGAGGACCGCGAGACCATGGACCGTGCCAACAAGATCGTCACC
GAGGAGGATGAGAAGGCCATGGACAAGATCTACAAGATTGAAGGCACCCTCCGCCGTGTCATCGGTATCCACTCT
CGTCGCAAGTTCAAGAACACCTACGAGTACGAGATCTCTTGGTCTCTGGGTGACAACGTCGGCATGAAGTCCGAG
AAGTGGACTCCTCTCATGTCCGCTGACAACACCTGGTTGCCTCGCTCCGAGATTATTGTCTCTCACCCCAAGCAG
GTCGCTGAGGTTGATCAGAAGGAGGCCCTCGCCTCCGGTCAGTTCCGTCCCCTTGTCCGCAAGGAGATCGAGCAG
CACTGCGCCAACTTTGGTCTCGATGCCGAGCTTGTTTCTCACTCTCGCATGCGCGGTCTCTCCGGTGGCCAGCGT
GTTAAGGTCGTTCTCGCCGCTTGCTCGTGGCAGCGTCCTCACCTTATCGTCCTTGACGAGCCCACTAACTACCTC
GACCGTGACTCCCTCGGTGCCCTCTCCAAGGCTATCAAGTCTTTCGAGGGTGGTGTTGTTATCATTACTCACTCC
CGTGAGTTCACTGAGCACCTGACTGAGGAAGTCTGGGCCGTCAACGACGGTGTCATGACCCCCTCCGGACACAAT
TGGGTCCAGGGTCAGGGCTCTGGCCCCCGTCTCGACGCCAAGGGTGACGATGATGAGGACAAGTTCGATGCCATG
GGCAACAAGATCGTTGTTACAAAGAAGGTCAAGCTTACTGGTAAGTTATCCAATCATTACTTCCTTATGCATCAC
AATGTTCAAATTCTAATTGTTCTCTTACAGGCTCTGAGCTTCGCAAGAAGAAGAAGGATCGTGCTGCCCGCCGCA
AGCGTGGTGAGGAGGTGTTCTCCGATGAGGATGACCTTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail