Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g8922.t1
Gene name
Locationscaffold_38:203993..205698
Strand+
Gene length (bp)1705
Transcript length (bp)1389
Coding sequence length (bp)1389
Protein length (aa) 463

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01490 Aa_trans Transmembrane amino acid transporter protein 8.4E-45 51 438

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 68 0.45

Transmembrane Domains

Domain # Start End Length
1 54 73 19
2 77 99 22
3 137 159 22
4 164 181 17
5 193 212 19
6 232 254 22
7 267 289 22
8 309 331 22
9 352 374 22
10 379 401 22
11 414 436 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 13.49 6.01 20.97
5d_25C Five days - 25 degrees Celsius 17.73 8.57 26.88
7d_25C Seven days - 25 degrees Celsius 17.31 8.24 26.39
10d_25C Ten days - 25 degrees Celsius 25.92 13.79 38.06
7d_15C Seven days - 15 degrees Celsius 14.56 6.66 22.46
7d_30C Seven days - 30 degrees Celsius 24.77 12.88 36.66

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.431312 no
3d_25C 7d_25C 0.477629 no
3d_25C 7d_15C 0.865333 no
3d_25C 7d_30C 0.032612 yes
3d_25C 10d_25C 0.022435 yes
5d_25C 7d_25C 0.960158 no
5d_25C 7d_15C 0.586869 no
5d_25C 7d_30C 0.253534 no
5d_25C 10d_25C 0.178866 no
7d_25C 7d_15C 0.639826 no
7d_25C 7d_30C 0.211485 no
7d_25C 10d_25C 0.146409 no
7d_15C 7d_30C 0.052547 no
7d_15C 10d_25C 0.033043 yes
7d_30C 10d_25C 0.912126 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g8922.t1
MNTSQSDIDLQSLRSVKRKLDPENDSVVPKPDLEESDPFGDESQSGVKYKTMAWWQAGMIMIAETISLGILALPK
ALAVLGLVPGILTILGVGIISTYTAYTIGRFKCRHVQVHSMADAGDLLMGRVGRTTLDVAQLVFFVLVMGSHILT
FSIMMNVLTEHSSCTIVFSVVGLLASFMLTLPRRLERLSHISSVSFVSIVGAVLTGMIGVTLVKQGPVEVPAFSP
PPKVHDACLAIANIIFAYAGHVAFFTLFSELKELKDFPKALALLQMSEMVLYTVASIMIYAYVGPTVNSPALNSS
GQLFRKISYAIALPTILIGGVVNAHVAVKFIYVRVFRGTNSMHTQSFRARVVWTVTCAGLWILSWIIAEAIPVFN
DVLGLASSLFASWFSFGLPGLFWLYLNRTCWYMTWRQRALFGFNLFLVFLGFVICIVGLYSSIRSIFNNLREGVG
GGSFSCADNSLY*
Coding >Pro_DTO377G3_2|g8922.t1
ATGAATACCAGTCAGTCTGATATTGACCTCCAGTCGCTGCGCTCTGTGAAGCGCAAGTTGGACCCGGAGAACGAT
TCTGTTGTACCAAAGCCAGATCTGGAGGAGTCCGATCCCTTTGGAGACGAAAGCCAATCTGGCGTGAAGTACAAG
ACCATGGCGTGGTGGCAAGCCGGCATGATCATGATCGCAGAAACCATCTCGCTTGGTATTCTCGCGCTGCCCAAA
GCGCTTGCTGTTCTAGGTCTTGTTCCCGGCATCCTAACCATCCTCGGGGTTGGGATCATCTCGACGTATACCGCA
TATACCATCGGGCGATTCAAATGCCGCCATGTCCAAGTGCACAGTATGGCTGATGCTGGTGATCTTCTGATGGGA
AGGGTTGGACGGACTACACTGGATGTGGCCCAGCTCGTCTTTTTTGTGTTGGTCATGGGAAGCCATATCCTCACT
TTTTCCATCATGATGAACGTTCTCACCGAACATTCTTCCTGCACCATCGTATTTTCGGTTGTCGGTCTACTCGCC
TCGTTCATGTTGACCCTTCCACGGCGACTTGAGAGGCTTTCTCACATCTCCTCCGTGAGCTTTGTGAGTATCGTC
GGAGCGGTTCTTACTGGTATGATTGGAGTCACCCTTGTCAAACAAGGCCCAGTGGAGGTCCCAGCTTTTTCGCCT
CCGCCCAAAGTGCATGATGCGTGCCTTGCTATTGCAAACATAATATTTGCGTACGCAGGACATGTTGCATTCTTT
ACCCTTTTCTCCGAGCTCAAAGAGCTCAAGGACTTCCCAAAGGCTCTGGCGCTTTTGCAGATGAGTGAAATGGTC
TTGTACACAGTGGCTTCTATTATGATATATGCCTATGTTGGGCCAACTGTCAACTCACCTGCTCTCAATTCTTCG
GGACAATTGTTTCGCAAGATTTCCTATGCAATCGCACTACCTACGATCCTGATCGGGGGTGTGGTGAACGCCCAT
GTTGCCGTCAAGTTCATTTACGTTCGTGTCTTCCGGGGGACCAACTCGATGCATACCCAGTCATTTAGGGCGCGG
GTAGTTTGGACTGTTACATGTGCGGGGCTTTGGATCTTGTCGTGGATCATCGCCGAGGCAATACCGGTTTTCAAC
GATGTACTAGGGCTTGCGAGTTCCTTATTTGCTAGCTGGTTTTCATTCGGTCTACCTGGGCTATTCTGGCTCTAT
CTGAACCGAACTTGTTGGTACATGACCTGGCGACAGAGGGCATTGTTTGGCTTCAATCTTTTTCTGGTGTTTCTT
GGATTTGTCATTTGCATTGTCGGGTTGTACTCGTCTATTCGGTCGATCTTTAACAACCTTCGCGAGGGTGTCGGA
GGAGGTAGCTTCTCATGTGCCGACAATTCCCTCTATTGA
Transcript >Pro_DTO377G3_2|g8922.t1
ATGAATACCAGTCAGTCTGATATTGACCTCCAGTCGCTGCGCTCTGTGAAGCGCAAGTTGGACCCGGAGAACGAT
TCTGTTGTACCAAAGCCAGATCTGGAGGAGTCCGATCCCTTTGGAGACGAAAGCCAATCTGGCGTGAAGTACAAG
ACCATGGCGTGGTGGCAAGCCGGCATGATCATGATCGCAGAAACCATCTCGCTTGGTATTCTCGCGCTGCCCAAA
GCGCTTGCTGTTCTAGGTCTTGTTCCCGGCATCCTAACCATCCTCGGGGTTGGGATCATCTCGACGTATACCGCA
TATACCATCGGGCGATTCAAATGCCGCCATGTCCAAGTGCACAGTATGGCTGATGCTGGTGATCTTCTGATGGGA
AGGGTTGGACGGACTACACTGGATGTGGCCCAGCTCGTCTTTTTTGTGTTGGTCATGGGAAGCCATATCCTCACT
TTTTCCATCATGATGAACGTTCTCACCGAACATTCTTCCTGCACCATCGTATTTTCGGTTGTCGGTCTACTCGCC
TCGTTCATGTTGACCCTTCCACGGCGACTTGAGAGGCTTTCTCACATCTCCTCCGTGAGCTTTGTGAGTATCGTC
GGAGCGGTTCTTACTGGTATGATTGGAGTCACCCTTGTCAAACAAGGCCCAGTGGAGGTCCCAGCTTTTTCGCCT
CCGCCCAAAGTGCATGATGCGTGCCTTGCTATTGCAAACATAATATTTGCGTACGCAGGACATGTTGCATTCTTT
ACCCTTTTCTCCGAGCTCAAAGAGCTCAAGGACTTCCCAAAGGCTCTGGCGCTTTTGCAGATGAGTGAAATGGTC
TTGTACACAGTGGCTTCTATTATGATATATGCCTATGTTGGGCCAACTGTCAACTCACCTGCTCTCAATTCTTCG
GGACAATTGTTTCGCAAGATTTCCTATGCAATCGCACTACCTACGATCCTGATCGGGGGTGTGGTGAACGCCCAT
GTTGCCGTCAAGTTCATTTACGTTCGTGTCTTCCGGGGGACCAACTCGATGCATACCCAGTCATTTAGGGCGCGG
GTAGTTTGGACTGTTACATGTGCGGGGCTTTGGATCTTGTCGTGGATCATCGCCGAGGCAATACCGGTTTTCAAC
GATGTACTAGGGCTTGCGAGTTCCTTATTTGCTAGCTGGTTTTCATTCGGTCTACCTGGGCTATTCTGGCTCTAT
CTGAACCGAACTTGTTGGTACATGACCTGGCGACAGAGGGCATTGTTTGGCTTCAATCTTTTTCTGGTGTTTCTT
GGATTTGTCATTTGCATTGTCGGGTTGTACTCGTCTATTCGGTCGATCTTTAACAACCTTCGCGAGGGTGTCGGA
GGAGGTAGCTTCTCATGTGCCGACAATTCCCTCTATTGA
Gene >Pro_DTO377G3_2|g8922.t1
ATGAATACCAGTCAGTCTGATATTGACCTCCAGTCGCTGCGCTCTGTGAAGCGCAAGTTGGACCCGGAGAACGAT
TCTGTTGTACCAAAGCCAGATCTGGAGGAGTCCGATCCCTTTGGAGACGAAAGCCAATCTGGCGTGAAGTACAAG
ACCATGGCGTGGTGGTAAGTGTTTCCTTTTCCACAGGCAGGATGAAGCTCATCCTTTCAATAGGCAAGCCGGCAT
GAGTAAGTCAATGTCTTACATATTGCCCAGCTTTCTCTAACAAACCGGTCAGTCATGATCGCAGAAACCATCTCG
CTTGGTATTCTCGCGCTGCCCAAAGCGCTTGCTGTTCTAGGTCTTGTTCCGTACATTCTCCTCCCCGCTGGCTGC
AAAGGCCGATGAGCTAACCTGTTTGTTCAGCGGCATCCTAACCATCCTCGGGGTTGGGATCATCTCGACGTATAC
CGCATATACCATCGGGCGATTCAAATGCCGCCATGTCCAAGTGCACAGTATGGCTGATGCTGGTGATCTTCTGAT
GGGAAGGGTTGGACGGACTACACTGGATGTGGCCCAGCTCGTCTTTTTTGTGTTGGTCATGGGAAGCCATATCCT
CACTTTTTCCATCATGATGAACGTTCTCACCGAACATTCTTCCTGCACCATCGTATTTTCGGTTGTCGGTCTACT
CGCCTCGTTCATGTTGACCCTTCCACGGCGACTTGAGAGGCTTTCTCACATCTCCTCCGTGAGCTTTGTGAGTAT
CGTCGGAGCGGTTCTTACTGGTATGATTGGAGTCACCCTTGTCAAACAAGGCCCAGTGGAGGTCCCAGCTTTTTC
GCCTCCGCCCAAAGTGCATGATGCGTGCCTTGCTATTGCAAACATAATATTTGCGTACGCAGGACATGTTGCATT
CTTTACCCTTTTCTCCGAGCTCAAAGAGCTCAAGGACTTCCCAAAGGCTCTGGCGCTTTTGCAGATGAGTGAAAT
GGTCTTGTACACAGTGGCTTCTATTATGATATATGCCTATGTTGGGCCAACTGTCAACTCACCTGCTCTCAATTC
TTCGGGACAATTGTTTCGCAAGATTTCCTATGCAATCGCACTACCTACGGTACGTATCTTTTTCCGTGTACTTCT
TTTGGATATGAGCTTAACCAATGCACAGATCCTGATCGGGGGTGTGGTGAACGCCCATGTTGCCGTCAAGTTCAT
TTACGTTCGTGTCTTCCGGGGGACCAACTCGATGCATACCCAGTCATTTAGGGCGCGGGTAGTTTGGACTGTTAC
ATGTGCGGGGCTTTGGATCTTGTCGTGGATCATCGCCGAGGCAATACCGGTTTTCAACGATGTACTAGGGCTTGC
GGTGTGTACTACCTGTCCCTGACCCCACCTGCAGCGAGTACTAATCATTCCAACCAGAGTTCCTTATTTGCTAGC
TGGTTTTCATTCGGTCTACCTGGGCTATTCTGGCTCTATCTGAACCGAACTTGTTGGTACATGACCTGGCGACAG
AGGGCATTGTTTGGCTTCAATCTTTTTCTGGTGTTTCTTGGATTTGTCATTGTAAGTTGAGCTCTACTGTGGTTT
GAAGGGTCGAGTTAACCTACGCCACCAGTGCATTGTCGGGTTGTACTCGTCTATTCGGTCGATCTTTAACAACCT
TCGCGAGGGTGTCGGAGGAGGTAGCTTCTCATGTGCCGACAATTCCCTCTATTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail