Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g8921.t1
Gene name
Locationscaffold_38:201469..203750
Strand+
Gene length (bp)2281
Transcript length (bp)2097
Coding sequence length (bp)2097
Protein length (aa) 699

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01266 DAO FAD dependent oxidoreductase 5.1E-51 82 453
PF16901 DAO_C C-terminal domain of alpha-glycerophosphate oxidase 1.7E-42 499 626
PF00890 FAD_binding_2 FAD binding domain 4.6E-09 82 315

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0003674 molecular_function No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 22 0.5

Transmembrane Domains

Domain # Start End Length
1 9 31 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 91.68 55.97 127.40
5d_25C Five days - 25 degrees Celsius 75.97 46.59 105.34
7d_25C Seven days - 25 degrees Celsius 66.37 40.71 92.03
10d_25C Ten days - 25 degrees Celsius 56.76 34.70 78.83
7d_15C Seven days - 15 degrees Celsius 89.30 54.54 124.05
7d_30C Seven days - 30 degrees Celsius 57.68 35.35 80.02

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.440854 no
3d_25C 7d_25C 0.135418 no
3d_25C 7d_15C 0.937523 no
3d_25C 7d_30C 0.021921 yes
3d_25C 10d_25C 0.020393 yes
5d_25C 7d_25C 0.602276 no
5d_25C 7d_15C 0.523518 no
5d_25C 7d_30C 0.212879 no
5d_25C 10d_25C 0.183361 no
7d_25C 7d_15C 0.177767 no
7d_25C 7d_30C 0.590804 no
7d_25C 10d_25C 0.540389 no
7d_15C 7d_30C 0.033480 yes
7d_15C 10d_25C 0.032181 yes
7d_30C 10d_25C 0.964042 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g8921.t1
MAARHSRKFLRPLLYTSAAAAAGAGVIYISYRPRNIPGLEAPAVPPPGYYKGKLVPPSFPSIKSRLEQIEDLKRS
EEEEEYDLLVIGAGATGAGIALDAATRGLKVAVVERDDFSSGTSSKSTKLVHGGVRYLEKAVWELDYNQYALVKE
ALRERKYFLNTAPHLSSWLPIMVPVQKWWQAPYFWAGTKAYDFLAGSEGIETSYFLTKSKAIDAFPMLKRDNIIG
AMVYYDGAHNDSRMNVSLAMTAALYGTTVVNHLEVTGLNKDASGRLCGARAKDIVAEKNGEVAKEFNIRAKGVIN
ATGPFSDSIRKMDEPNVKEIVAPSAGVHIILPGYFSPSNMGLIDPSTSDGRVIFFLPWQGNTIAGTTDQPCEIEA
QPQPTEKDINWILSEIRGYIAPDITVDRSDVLAAWSGIRPLVRDPKVKNSEALVRNHLVTVSQSGLLTCAGGKWT
TYRQMAEEAVDEAVKSFKLKPRQLNSLPDISGVGGSDLVADGAVLDGSCQTHQVRLIGAHGYSKTLFINLIQHFG
LETDVAKHLTESYGDRSWQVAALSSPTSERFPVRGCRISPMYPFVDGEIRYAVRHEYAQTAVDVIARRTRLAFLN
AEAALESLPTVIDTMAEELKWTNARKDLEWKDSLTFLSSMGLPKSFMGLSRHDVQNGRVTQVDDAERATFSRKEP
PADMIESDVRATIEPPAATPALG*
Coding >Pro_DTO377G3_2|g8921.t1
ATGGCCGCTCGGCACTCGCGCAAGTTTTTGCGACCTCTCCTCTACACATCGGCGGCCGCCGCCGCAGGAGCAGGT
GTTATCTACATTTCTTACCGTCCGCGAAATATTCCAGGCCTCGAAGCCCCTGCCGTTCCTCCGCCAGGTTACTAC
AAAGGCAAGCTGGTCCCGCCCAGTTTCCCTTCCATCAAGTCTCGCCTCGAACAGATTGAGGACCTCAAGCGCAGT
GAGGAGGAGGAGGAATATGATCTGCTTGTCATTGGTGCCGGAGCCACTGGAGCCGGTATCGCATTAGATGCCGCC
ACACGAGGCCTGAAGGTCGCGGTGGTGGAGAGAGATGATTTCAGTTCGGGTACTAGTAGTAAGAGTACCAAGCTG
GTACACGGTGGTGTCCGTTACCTTGAAAAGGCCGTGTGGGAGTTGGACTACAACCAATATGCGCTAGTCAAGGAG
GCTCTCAGAGAGCGCAAGTACTTCCTAAACACAGCTCCCCATCTGTCATCATGGCTGCCAATCATGGTGCCTGTT
CAGAAATGGTGGCAGGCTCCGTATTTCTGGGCTGGCACCAAGGCCTATGACTTCTTGGCTGGTTCCGAGGGCATT
GAGACCTCGTACTTCCTCACCAAGAGTAAGGCCATTGATGCGTTCCCCATGCTGAAGCGTGACAACATCATTGGA
GCAATGGTGTACTATGATGGTGCTCACAACGACTCCCGCATGAACGTCTCCCTCGCTATGACCGCTGCGCTCTAC
GGTACCACTGTCGTGAACCACTTGGAGGTCACCGGACTGAACAAGGATGCATCCGGCAGGCTGTGCGGTGCGCGC
GCCAAGGACATCGTCGCAGAGAAGAACGGCGAGGTCGCCAAGGAGTTCAACATTCGCGCCAAGGGTGTCATCAAC
GCCACTGGTCCCTTCTCTGATTCCATCCGCAAGATGGATGAGCCCAATGTCAAGGAGATTGTGGCCCCCAGTGCT
GGTGTTCACATCATCCTGCCCGGTTACTTCAGCCCCTCAAACATGGGTCTCATTGACCCTTCCACCTCGGATGGA
CGTGTGATTTTCTTCCTGCCGTGGCAGGGTAACACCATCGCCGGTACCACTGACCAGCCCTGTGAGATTGAGGCT
CAGCCCCAGCCCACTGAGAAGGATATAAACTGGATTCTTTCGGAGATTCGTGGCTACATCGCCCCCGATATCACC
GTCGACCGAAGCGACGTCCTTGCTGCCTGGTCTGGCATCCGTCCCTTGGTGCGCGATCCCAAGGTGAAGAACTCG
GAGGCTCTCGTCCGCAACCACCTGGTGACCGTCTCTCAGTCTGGACTGTTGACTTGCGCCGGTGGTAAGTGGACT
ACTTACCGCCAGATGGCCGAGGAGGCCGTGGACGAGGCAGTCAAATCGTTCAAGCTCAAGCCCCGCCAGCTCAAC
AGCCTTCCCGACATCAGTGGTGTCGGAGGCAGTGATCTGGTTGCTGACGGTGCCGTTCTCGACGGTAGCTGCCAG
ACCCACCAGGTGCGCCTCATTGGTGCCCACGGTTACTCCAAGACCCTCTTCATCAACCTTATCCAGCACTTCGGT
CTCGAGACCGATGTGGCCAAGCACCTCACCGAGTCGTACGGTGATCGCTCATGGCAGGTCGCTGCCTTGTCTTCC
CCTACCAGCGAACGTTTCCCCGTGCGCGGCTGCCGTATCTCCCCTATGTACCCCTTCGTTGATGGTGAGATTCGC
TACGCCGTTCGTCACGAGTATGCCCAGACTGCCGTCGACGTGATTGCCCGTCGCACTCGTCTGGCTTTCCTGAAC
GCCGAGGCCGCCCTTGAATCCCTCCCCACTGTGATTGACACAATGGCCGAGGAGTTGAAGTGGACCAACGCCCGT
AAGGATCTCGAGTGGAAGGATTCCTTGACTTTCCTTTCATCCATGGGTCTGCCTAAGAGCTTCATGGGCCTGTCG
CGTCATGATGTCCAGAATGGCCGTGTTACGCAGGTTGATGATGCCGAGCGTGCGACTTTCTCCCGTAAAGAACCC
CCCGCGGATATGATTGAGAGTGACGTTCGTGCTACTATTGAACCCCCTGCCGCAACACCCGCGCTCGGCTAG
Transcript >Pro_DTO377G3_2|g8921.t1
ATGGCCGCTCGGCACTCGCGCAAGTTTTTGCGACCTCTCCTCTACACATCGGCGGCCGCCGCCGCAGGAGCAGGT
GTTATCTACATTTCTTACCGTCCGCGAAATATTCCAGGCCTCGAAGCCCCTGCCGTTCCTCCGCCAGGTTACTAC
AAAGGCAAGCTGGTCCCGCCCAGTTTCCCTTCCATCAAGTCTCGCCTCGAACAGATTGAGGACCTCAAGCGCAGT
GAGGAGGAGGAGGAATATGATCTGCTTGTCATTGGTGCCGGAGCCACTGGAGCCGGTATCGCATTAGATGCCGCC
ACACGAGGCCTGAAGGTCGCGGTGGTGGAGAGAGATGATTTCAGTTCGGGTACTAGTAGTAAGAGTACCAAGCTG
GTACACGGTGGTGTCCGTTACCTTGAAAAGGCCGTGTGGGAGTTGGACTACAACCAATATGCGCTAGTCAAGGAG
GCTCTCAGAGAGCGCAAGTACTTCCTAAACACAGCTCCCCATCTGTCATCATGGCTGCCAATCATGGTGCCTGTT
CAGAAATGGTGGCAGGCTCCGTATTTCTGGGCTGGCACCAAGGCCTATGACTTCTTGGCTGGTTCCGAGGGCATT
GAGACCTCGTACTTCCTCACCAAGAGTAAGGCCATTGATGCGTTCCCCATGCTGAAGCGTGACAACATCATTGGA
GCAATGGTGTACTATGATGGTGCTCACAACGACTCCCGCATGAACGTCTCCCTCGCTATGACCGCTGCGCTCTAC
GGTACCACTGTCGTGAACCACTTGGAGGTCACCGGACTGAACAAGGATGCATCCGGCAGGCTGTGCGGTGCGCGC
GCCAAGGACATCGTCGCAGAGAAGAACGGCGAGGTCGCCAAGGAGTTCAACATTCGCGCCAAGGGTGTCATCAAC
GCCACTGGTCCCTTCTCTGATTCCATCCGCAAGATGGATGAGCCCAATGTCAAGGAGATTGTGGCCCCCAGTGCT
GGTGTTCACATCATCCTGCCCGGTTACTTCAGCCCCTCAAACATGGGTCTCATTGACCCTTCCACCTCGGATGGA
CGTGTGATTTTCTTCCTGCCGTGGCAGGGTAACACCATCGCCGGTACCACTGACCAGCCCTGTGAGATTGAGGCT
CAGCCCCAGCCCACTGAGAAGGATATAAACTGGATTCTTTCGGAGATTCGTGGCTACATCGCCCCCGATATCACC
GTCGACCGAAGCGACGTCCTTGCTGCCTGGTCTGGCATCCGTCCCTTGGTGCGCGATCCCAAGGTGAAGAACTCG
GAGGCTCTCGTCCGCAACCACCTGGTGACCGTCTCTCAGTCTGGACTGTTGACTTGCGCCGGTGGTAAGTGGACT
ACTTACCGCCAGATGGCCGAGGAGGCCGTGGACGAGGCAGTCAAATCGTTCAAGCTCAAGCCCCGCCAGCTCAAC
AGCCTTCCCGACATCAGTGGTGTCGGAGGCAGTGATCTGGTTGCTGACGGTGCCGTTCTCGACGGTAGCTGCCAG
ACCCACCAGGTGCGCCTCATTGGTGCCCACGGTTACTCCAAGACCCTCTTCATCAACCTTATCCAGCACTTCGGT
CTCGAGACCGATGTGGCCAAGCACCTCACCGAGTCGTACGGTGATCGCTCATGGCAGGTCGCTGCCTTGTCTTCC
CCTACCAGCGAACGTTTCCCCGTGCGCGGCTGCCGTATCTCCCCTATGTACCCCTTCGTTGATGGTGAGATTCGC
TACGCCGTTCGTCACGAGTATGCCCAGACTGCCGTCGACGTGATTGCCCGTCGCACTCGTCTGGCTTTCCTGAAC
GCCGAGGCCGCCCTTGAATCCCTCCCCACTGTGATTGACACAATGGCCGAGGAGTTGAAGTGGACCAACGCCCGT
AAGGATCTCGAGTGGAAGGATTCCTTGACTTTCCTTTCATCCATGGGTCTGCCTAAGAGCTTCATGGGCCTGTCG
CGTCATGATGTCCAGAATGGCCGTGTTACGCAGGTTGATGATGCCGAGCGTGCGACTTTCTCCCGTAAAGAACCC
CCCGCGGATATGATTGAGAGTGACGTTCGTGCTACTATTGAACCCCCTGCCGCAACACCCGCGCTCGGCTAG
Gene >Pro_DTO377G3_2|g8921.t1
ATGGCCGCTCGGCACTCGCGCAAGTTTTTGCGACCTCTCCTCTACACATCGGCGGCCGCCGCCGCAGGAGCAGGT
GTTATCTACATTTCTTACCGTCCGCGAAATATTCCAGGCCTCGAAGCCCCTGCCGTTCCTCCGCCAGGTTACTAC
AAAGGCAAGCTGGTCCCGCCCAGTTTCCCTTCCATCAAGTCTCGCCTCGAACAGATTGAGGACCTCAAGCGCAGT
GAGGAGGAGGAGGAATATGATCTGCTTGTCATTGGTGCCGGAGCCACTGGAGCCGGTATCGCATTAGATGCCGCC
ACACGAGGCCTGAAGGTCGCGGTGGTGGAGAGAGATGATTTCAGTTCGGGTACTAGTAGTAAGAGTACCAAGCTG
GTACACGGTGGTGTCCGTTACCTTGAAAAGGCCGTGTGGGAGTTGGACTACAACCAGTGAGATTGTCCTTTCTTC
CTCGGAAAGAGATGAGGTCGGAATGACCGCATCCCCGCGCATCCCTTCTAACAATCGCATCGCAGATATGCGCTA
GTCAAGGAGGCTCTCAGAGAGCGCAAGTACTTCCTAAACACAGCTCCCCATCTGTCATCATGGCTGCCAATCATG
GTGCCTGTTCAGAAATGGTGGCAGGCTCCGTATTTCTGGGCTGGCACCAAGGCCTATGACTTCTTGGCTGGTTCC
GAGGGCATTGAGACCTCGTACTTCCTCACCAAGAGTAAGGCCATTGATGCGTTCCCCATGCTGAAGCGTGACAAC
ATCATTGGAGCAATGGTGTACTATGGTGAGTAGCCAACACGGACCCCGCAAATGATCTAGGCTAATTCCCGATCA
GATGGTGCTCACAACGACTCCCGCATGAACGTCTCCCTCGCTATGACCGCTGCGCTCTACGGTACCACTGTCGTG
AACCACTTGGAGGTCACCGGACTGAACAAGGATGCATCCGGCAGGCTGTGCGGTGCGCGCGCCAAGGACATCGTC
GCAGAGAAGAACGGCGAGGTCGCCAAGGAGTTCAACATTCGCGCCAAGGGTGTCATCAACGCCACTGGTCCCTTC
TCTGATTCCATCCGCAAGATGGATGAGCCCAATGTCAAGGAGATTGTGGCCCCCAGTGCTGGTGTTCACATCATC
CTGCCCGGTTACTTCAGCCCCTCAAACATGGGTCTCATTGACCCTTCCACCTCGGATGGACGTGTGATTTTCTTC
CTGCCGTGGCAGGGTAACACCATCGCCGGTACCACTGACCAGCCCTGTGAGATTGAGGCTCAGCCCCAGCCCACT
GAGAAGGATATAAACTGGATTCTTTCGGAGATTCGTGGCTACATCGCCCCCGATATCACCGTCGACCGAAGCGAC
GTCCTTGCTGCCTGGTCTGGCATCCGTCCCTTGGTGCGCGATCCCAAGGTGAAGAACTCGGAGGCTCTCGTCCGC
AACCACCTGGTGACCGTCTCTCAGTCTGGACTGTTGACTTGCGCCGGTGGTAAGTGGACTACTTACCGCCAGATG
GCCGAGGAGGCCGTGGACGAGGCAGTCAAATCGTTCAAGCTCAAGCCCCGCCAGCTCAACAGCCTTCCCGACATC
AGTGGTGTCGGAGGCAGTGATCTGGTTGCTGACGGTGCCGTTCTCGACGGTAGCTGCCAGACCCACCAGGTGCGC
CTCATTGGTGCCCACGGTTACTCCAAGACCCTCTTCATCAACCTTATCCAGCACTTCGGTCTCGAGACCGATGTG
GCCAAGCACCTCACCGAGTCGTACGGTGATCGCTCATGGCAGGTCGCTGCCTTGTCTTCCCCTACCAGCGAACGT
TTCCCCGTGCGCGGCTGCCGTATCTCCCCTATGTACCCCTTCGTTGATGGTGAGATTCGCTACGCCGTTCGTCAC
GAGTATGCCCAGACTGCCGTCGACGTGATTGCCCGTCGCACTCGTCTGGCTTTCCTGAACGCCGAGGCCGCCCTT
GAATCCCTCCCCACTGTGATTGACACAATGGCCGAGGAGTTGAAGTGGACCAACGCCCGTAAGGATCTCGAGTGG
AAGGATTCCTTGACTTTCCTTTCATCCATGGGTCTGCCTAAGAGCTTCATGGGCCTGTCGCGTCATGATGTCCAG
AATGGCCGTGTTACGCAGGTTGATGATGCCGAGCGTGCGACTTTCTCCCGTAAAGGTATGTTTGTAACAAACATT
TCGATGAACCACAGTGCTGACCATTCTAGAACCCCCCGCGGATATGATTGAGAGTGACGTTCGTGCTACTATTGA
ACCCCCTGCCGCAACACCCGCGCTCGGCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail