Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g8917.t1
Gene name
Locationscaffold_38:192343..194438
Strand-
Gene length (bp)2095
Transcript length (bp)1914
Coding sequence length (bp)1914
Protein length (aa) 638

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07558 Shugoshin_N Shugoshin N-terminal coiled-coil region 8.2E-19 17 61
PF07557 Shugoshin_C Shugoshin C terminus 6.1E-10 433 455

GO

GO Term Description Terminal node
GO:0045132 meiotic chromosome segregation Yes
GO:0000775 chromosome, centromeric region Yes
GO:0005634 nucleus Yes
GO:0043231 intracellular membrane-bounded organelle No
GO:0005575 cellular_component No
GO:0043229 intracellular organelle No
GO:0007059 chromosome segregation No
GO:0043226 organelle No
GO:0098687 chromosomal region No
GO:0022414 reproductive process No
GO:0022402 cell cycle process No
GO:0110165 cellular anatomical entity No
GO:0009987 cellular process No
GO:0098813 nuclear chromosome segregation No
GO:0043227 membrane-bounded organelle No
GO:1903046 meiotic cell cycle process No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 25 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g8917.t1
MARLNDYAAPAESIEALKRRFVRQNREIARVNSLQSLRIRSLESEVSHLISENVSLRKQVINLTRETERLEAGKM
LHNGIYDIKSKLDAKLAELSNLAADLGSLPRKVGKLCDTQFDRPKQAAESRPRTEDMEGEDGRLPAIVEDKYYPR
RTLEPQELDSLLQDDQSILDSPPRFSFMPEEGDALIENSSPSPPESTFRTEINNDIPEEPEPSFPPTLETRKKKK
RSSSIVAPEISPPPTDRQPSPPIDTTQHTTSVSTKRKYVPEDDDRFTSNLDVDDDEFQFTRPSHTPKKQTIPFED
TQRDQSPTQSHVKLTRGSRTPVLSMRRVLEPKSANSNLGSPKKARMSSYQDSKLMQRPTKGDENSNSPQKVKNVD
KLSGNTVNQKPRVSRSASSNKEKRARPAPPQVEEPASRQPEQSPHPNTMKTEEESATRHSRRRGAVVSYAEPNLR
DKMRRPTKEMIDAVALGSRRSSSFQAGRESLDGEGGNTQSHGTLPADFTLAAQSSDLFTVDESSDQLLAMVSRRK
RKASSAPKDDPDVGKPSSGLKKEIEDSLADISAQVSQKPLNSRRQPRRHSSNPKNTTADMAQYDTDQGEPQSPNG
DSPEDEDSFGPGPNGSTMDSDVRRGQRVAARRKSMMV*
Coding >Pro_DTO377G3_2|g8917.t1
ATGGCTCGGTTGAATGACTATGCGGCTCCTGCTGAGTCCATTGAAGCGTTGAAGCGACGATTTGTGCGACAAAAT
CGGGAGATCGCGAGAGTGAATTCCTTGCAATCTCTTCGTATTCGCAGCCTAGAGTCAGAAGTATCACATCTAATT
TCGGAAAATGTGTCGCTTCGAAAACAGGTCATCAATCTTACCCGGGAAACCGAACGACTGGAAGCGGGGAAAATG
TTGCACAATGGAATATACGACATCAAATCCAAGCTAGATGCCAAACTAGCCGAGTTGAGCAATTTGGCCGCAGAT
TTGGGCTCATTACCCCGCAAGGTGGGCAAGCTCTGCGACACACAGTTCGATAGACCAAAACAGGCGGCAGAGTCG
AGACCTAGGACAGAAGACATGGAAGGCGAAGATGGAAGGCTTCCTGCCATTGTTGAGGACAAATATTACCCTCGA
CGGACTCTGGAGCCCCAAGAGCTTGACAGCCTGCTCCAAGACGACCAAAGTATTCTAGACTCCCCTCCTCGATTC
AGCTTTATGCCGGAGGAAGGGGATGCACTCATCGAAAATTCAAGCCCATCACCACCAGAATCAACATTCAGGACC
GAAATAAACAACGATATACCCGAAGAACCCGAGCCATCATTTCCTCCAACTCTCGAGACACGCAAGAAGAAAAAG
AGGTCGAGTTCGATCGTTGCGCCTGAAATTAGCCCCCCGCCAACAGATCGGCAACCAAGTCCACCCATCGATACA
ACACAGCACACAACATCGGTTTCAACGAAGCGAAAATACGTACCCGAAGACGATGACAGGTTCACTTCCAACCTT
GATGTCGACGACGACGAATTCCAATTCACCCGGCCCAGCCATACCCCAAAAAAGCAAACGATCCCATTCGAAGAT
ACACAGCGAGACCAGTCACCCACTCAAAGCCATGTCAAACTAACAAGAGGATCAAGAACCCCCGTTCTATCTATG
CGGAGGGTCCTCGAGCCAAAGAGTGCAAATTCCAATCTAGGCTCTCCGAAGAAGGCCCGCATGTCTTCGTACCAG
GACTCTAAGCTTATGCAAAGGCCCACCAAGGGCGACGAGAATAGCAACTCGCCACAGAAAGTTAAGAATGTCGAC
AAACTCAGTGGTAACACTGTCAATCAAAAGCCGCGAGTGTCCAGAAGCGCCTCTTCAAACAAAGAAAAGCGCGCT
CGCCCTGCTCCTCCCCAGGTGGAAGAGCCTGCCTCACGCCAGCCAGAACAGTCACCGCATCCGAATACAATGAAG
ACGGAGGAAGAGTCTGCCACTCGGCATTCACGACGTCGTGGTGCTGTGGTTAGCTATGCAGAGCCTAACCTACGG
GACAAGATGCGCCGCCCTACGAAGGAAATGATCGATGCTGTTGCACTTGGATCGCGAAGATCCTCCAGTTTCCAG
GCAGGCCGGGAAAGTTTGGACGGAGAGGGCGGCAACACCCAGTCTCATGGTACTCTCCCTGCTGATTTCACTCTT
GCGGCGCAGAGCTCAGATCTGTTTACCGTGGATGAATCCTCAGATCAGTTGCTAGCAATGGTCTCCCGGAGAAAA
CGCAAGGCGTCGTCAGCCCCAAAGGACGACCCCGATGTGGGGAAACCAAGCTCTGGCCTCAAGAAAGAGATTGAG
GATAGCCTCGCAGATATCTCGGCCCAAGTATCACAAAAACCATTGAATTCGAGGCGTCAGCCTCGACGTCACTCG
TCAAACCCCAAAAATACAACTGCAGACATGGCACAATACGACACGGACCAGGGTGAACCACAATCCCCAAACGGC
GACTCTCCAGAAGATGAAGACTCATTTGGACCGGGGCCAAACGGTTCTACAATGGACAGCGATGTCAGACGTGGC
CAGCGTGTTGCTGCAAGGAGAAAAAGCATGATGGTATAA
Transcript >Pro_DTO377G3_2|g8917.t1
ATGGCTCGGTTGAATGACTATGCGGCTCCTGCTGAGTCCATTGAAGCGTTGAAGCGACGATTTGTGCGACAAAAT
CGGGAGATCGCGAGAGTGAATTCCTTGCAATCTCTTCGTATTCGCAGCCTAGAGTCAGAAGTATCACATCTAATT
TCGGAAAATGTGTCGCTTCGAAAACAGGTCATCAATCTTACCCGGGAAACCGAACGACTGGAAGCGGGGAAAATG
TTGCACAATGGAATATACGACATCAAATCCAAGCTAGATGCCAAACTAGCCGAGTTGAGCAATTTGGCCGCAGAT
TTGGGCTCATTACCCCGCAAGGTGGGCAAGCTCTGCGACACACAGTTCGATAGACCAAAACAGGCGGCAGAGTCG
AGACCTAGGACAGAAGACATGGAAGGCGAAGATGGAAGGCTTCCTGCCATTGTTGAGGACAAATATTACCCTCGA
CGGACTCTGGAGCCCCAAGAGCTTGACAGCCTGCTCCAAGACGACCAAAGTATTCTAGACTCCCCTCCTCGATTC
AGCTTTATGCCGGAGGAAGGGGATGCACTCATCGAAAATTCAAGCCCATCACCACCAGAATCAACATTCAGGACC
GAAATAAACAACGATATACCCGAAGAACCCGAGCCATCATTTCCTCCAACTCTCGAGACACGCAAGAAGAAAAAG
AGGTCGAGTTCGATCGTTGCGCCTGAAATTAGCCCCCCGCCAACAGATCGGCAACCAAGTCCACCCATCGATACA
ACACAGCACACAACATCGGTTTCAACGAAGCGAAAATACGTACCCGAAGACGATGACAGGTTCACTTCCAACCTT
GATGTCGACGACGACGAATTCCAATTCACCCGGCCCAGCCATACCCCAAAAAAGCAAACGATCCCATTCGAAGAT
ACACAGCGAGACCAGTCACCCACTCAAAGCCATGTCAAACTAACAAGAGGATCAAGAACCCCCGTTCTATCTATG
CGGAGGGTCCTCGAGCCAAAGAGTGCAAATTCCAATCTAGGCTCTCCGAAGAAGGCCCGCATGTCTTCGTACCAG
GACTCTAAGCTTATGCAAAGGCCCACCAAGGGCGACGAGAATAGCAACTCGCCACAGAAAGTTAAGAATGTCGAC
AAACTCAGTGGTAACACTGTCAATCAAAAGCCGCGAGTGTCCAGAAGCGCCTCTTCAAACAAAGAAAAGCGCGCT
CGCCCTGCTCCTCCCCAGGTGGAAGAGCCTGCCTCACGCCAGCCAGAACAGTCACCGCATCCGAATACAATGAAG
ACGGAGGAAGAGTCTGCCACTCGGCATTCACGACGTCGTGGTGCTGTGGTTAGCTATGCAGAGCCTAACCTACGG
GACAAGATGCGCCGCCCTACGAAGGAAATGATCGATGCTGTTGCACTTGGATCGCGAAGATCCTCCAGTTTCCAG
GCAGGCCGGGAAAGTTTGGACGGAGAGGGCGGCAACACCCAGTCTCATGGTACTCTCCCTGCTGATTTCACTCTT
GCGGCGCAGAGCTCAGATCTGTTTACCGTGGATGAATCCTCAGATCAGTTGCTAGCAATGGTCTCCCGGAGAAAA
CGCAAGGCGTCGTCAGCCCCAAAGGACGACCCCGATGTGGGGAAACCAAGCTCTGGCCTCAAGAAAGAGATTGAG
GATAGCCTCGCAGATATCTCGGCCCAAGTATCACAAAAACCATTGAATTCGAGGCGTCAGCCTCGACGTCACTCG
TCAAACCCCAAAAATACAACTGCAGACATGGCACAATACGACACGGACCAGGGTGAACCACAATCCCCAAACGGC
GACTCTCCAGAAGATGAAGACTCATTTGGACCGGGGCCAAACGGTTCTACAATGGACAGCGATGTCAGACGTGGC
CAGCGTGTTGCTGCAAGGAGAAAAAGCATGATGGTATAA
Gene >Pro_DTO377G3_2|g8917.t1
ATGGCTCGGTTGAATGACTATGCGGCTCCTGCTGAGTCCATTGAAGCGTGTAAGTCGTGCAATTTACTACTATAC
TACAAAATTTGAGCTAGCAGTTGACATATGGCCTCCTTGTTTTCTATCCAGTGAAGCGACGATTTGTGCGACAAA
ATCGGGAGATCGCGAGAGTGAATTCCTTGCAATCTCTTCGTATTCGCAGCCTAGAGTCAGAAGTATCACATCTAA
TTTCGGAAAATGTGTCGCTTCGAAAACAGGTCATCAATCTTACCCGGGAAACCGAACGACTGGAAGCGGGGAAAA
TGTTGCACAATGGAATATACGACATCAAATCCAAGCTAGATGCCAAACTAGCCGAGTTGAGCAATTTGGCCGCAG
ATTTGGGCTCATTACCCCGCAAGGTGGGCAAGCTCTGCGACACACAGTTCGATAGACCAAAACAGGCGGCAGAGT
CGAGACCTAGGACAGAAGACATGGAAGGCGAAGATGGAAGGCTTCCTGCCATTGTTGAGGACAAATATTACCCTC
GACGGACTCTGGAGTAAGAATCTTCGAGATTTTGGGTCATTCCAAATTGCTAACATCTTATTCAGGCCCCAAGAG
CTTGACAGCCTGCTCCAAGACGACCAAAGTATTCTAGACTCCCCTCCTCGATTCAGCTTTATGCCGGAGGAAGGG
GATGCACTCATCGAAAATTCAAGCCCATCACCACCAGAATCAACATTCAGGACCGAAATAAACAACGATATACCC
GAAGAACCCGAGCCATCATTTCCTCCAACTCTCGAGACACGCAAGAAGAAAAAGAGGTCGAGTTCGATCGTTGCG
CCTGAAATTAGCCCCCCGCCAACAGATCGGCAACCAAGTCCACCCATCGATACAACACAGCACACAACATCGGTT
TCAACGAAGCGAAAATACGTACCCGAAGACGATGACAGGTTCACTTCCAACCTTGATGTCGACGACGACGAATTC
CAATTCACCCGGCCCAGCCATACCCCAAAAAAGCAAACGATCCCATTCGAAGATACACAGCGAGACCAGTCACCC
ACTCAAAGCCATGTCAAACTAACAAGAGGATCAAGAACCCCCGTTCTATCTATGCGGAGGGTCCTCGAGCCAAGT
ATGTTCTACTTTCTCATCTCTACAATGAGTGTAGCTAACAATTAGAACAGAGAGTGCAAATTCCAATCTAGGCTC
TCCGAAGAAGGCCCGCATGTCTTCGTACCAGGACTCTAAGCTTATGCAAAGGCCCACCAAGGGCGACGAGAATAG
CAACTCGCCACAGAAAGTTAAGAATGTCGACAAACTCAGTGGTAACACTGTCAATCAAAAGCCGCGAGTGTCCAG
AAGCGCCTCTTCAAACAAAGAAAAGCGCGCTCGCCCTGCTCCTCCCCAGGTGGAAGAGCCTGCCTCACGCCAGCC
AGAACAGTCACCGCATCCGAATACAATGAAGACGGAGGAAGAGTCTGCCACTCGGCATTCACGACGTCGTGGTGC
TGTGGTTAGCTATGCAGAGCCTAACCTACGGGACAAGATGCGCCGCCCTACGAAGGAAATGATCGATGCTGTTGC
ACTTGGATCGCGAAGATCCTCCAGTTTCCAGGCAGGCCGGGAAAGTTTGGACGGAGAGGGCGGCAACACCCAGTC
TCATGGTACTCTCCCTGCTGATTTCACTCTTGCGGCGCAGAGCTCAGATCTGTTTACCGTGGATGAATCCTCAGA
TCAGTTGCTAGCAATGGTCTCCCGGAGAAAACGCAAGGCGTCGTCAGCCCCAAAGGACGACCCCGATGTGGGGAA
ACCAAGCTCTGGCCTCAAGAAAGAGATTGAGGATAGCCTCGCAGATATCTCGGCCCAAGTATCACAAAAACCATT
GAATTCGAGGCGTCAGCCTCGACGTCACTCGTCAAACCCCAAAAATACAACTGCAGACATGGCACAATACGACAC
GGACCAGGGTGAACCACAATCCCCAAACGGCGACTCTCCAGAAGATGAAGACTCATTTGGACCGGGGCCAAACGG
TTCTACAATGGACAGCGATGTCAGACGTGGCCAGCGTGTTGCTGCAAGGAGAAAAAGCATGATGGTATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail