Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g8909.t1
Gene name
Locationscaffold_38:170304..173321
Strand-
Gene length (bp)3017
Transcript length (bp)2463
Coding sequence length (bp)2463
Protein length (aa) 821

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF14604 SH3_9 Variant SH3 domain 3.9E-13 665 712
PF14604 SH3_9 Variant SH3 domain 3.5E-11 769 816
PF00018 SH3_1 SH3 domain 2.6E-11 664 708
PF00018 SH3_1 SH3 domain 1.3E-12 768 813
PF00241 Cofilin_ADF Cofilin/tropomyosin-type actin-binding protein 9.4E-16 67 175
PF07653 SH3_2 Variant SH3 domain 7.8E-07 666 713
PF07653 SH3_2 Variant SH3 domain 4.0E-05 772 817

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0005622 intracellular Yes
GO:0003779 actin binding Yes
GO:0005488 binding No
GO:0005575 cellular_component No
GO:0044464 cell part No
GO:0008092 cytoskeletal protein binding No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 28 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g8909.t1
MKHVHVLAHSTPLLLSFLPDIVTKEKATPPPTWTHLKLDKLSLPSPRLFAGKSWLLSISRPMALRYQKVIRQCAF
QQDGGKESVLKVQSTGEGELADLIEEFSEGRVQFAYVKVTDSNTGLPKNVLIGWCGEGVPERTKGYFTSHLAAVA
KFLHGYHVQITARADGDLTPEGIVQRVADSSGSKYSVGEASARAPAPRPAVASKPAFTPTRSGGITPSPAARVLP
TPSRAGVNDDGWGVDAPPVTRTQLEKVQSAYQPTRVNLQELKANPTGSRQPAATASDDSSDVVRGGYQPVGKVDI
AAIRKQAAASGQLKDERPAIIKGSYEPIGKVDIAAIRARAQKPEANDNVPSSTAFNQQPTTLPERPAPSTAAERL
TTLPKPRVANKFGSSPSFPGTKPPLPVGLGPKPTTSAPIGTASRTFADEGGKTPAQIWAERKAKERGVAPSSGTT
EPTSTPAPIQSQPSGQSEWRSSYAGKSWAPVQTAQEKSYDPEQPVDAKANDQQEDKPQPHVSAIRDQFAQDTPTP
APAPLAPPAPPVPQASRPVPVPGLSSGPVESEPEHDAQQALPTPPPQPPRSPTPPTPERESSPIQIAMPVGRGTA
DSIADAHEEQYSPPPAMPVRSLQEAVPDEREIEDDSHDLGRAAAEATAPQQPEQPQGGPRAQIQYDYEKAEDNEI
ELREGEYVTDIEMVDEDWWVGVNTQGERGLFPANYVEIVEDTEPASHVPAASDHYEAEPEPEPAAAPVPAAPTPV
AAAAPSVATPSSNGVTATALYDYEAAEDNEIGFPEDAKISNVEFPDDDWWLGEYNGKQGLFPANYVRLDE*
Coding >Pro_DTO377G3_2|g8909.t1
ATGAAGCATGTGCATGTATTGGCACATTCAACCCCGCTGCTTTTATCCTTTTTGCCCGATATTGTAACAAAAGAA
AAAGCTACCCCTCCTCCCACGTGGACACATCTGAAACTTGACAAGCTTTCCCTTCCTTCTCCCCGCCTATTCGCC
GGAAAGTCATGGCTTCTCTCAATCTCTCGTCCAATGGCCCTTCGATATCAAAAAGTTATCAGACAGTGTGCCTTC
CAGCAAGATGGAGGTAAGGAGAGTGTCCTTAAGGTCCAGAGCACCGGAGAGGGTGAATTGGCGGATCTCATCGAG
GAATTTTCCGAAGGACGGGTGCAATTCGCCTATGTGAAGGTGACGGATTCCAACACCGGTCTTCCCAAAAACGTT
CTCATTGGCTGGTGTGGAGAAGGTGTGCCGGAACGAACAAAGGGTTACTTTACTAGCCACCTGGCTGCAGTTGCC
AAGTTCCTTCATGGATACCATGTGCAGATCACAGCCCGAGCAGATGGGGATCTAACCCCCGAGGGAATCGTCCAG
CGGGTGGCAGATTCCTCCGGCTCTAAGTATTCAGTAGGCGAGGCCTCAGCCCGGGCCCCAGCCCCCCGGCCTGCC
GTGGCTAGCAAGCCTGCTTTCACACCGACTCGATCTGGGGGCATCACTCCCAGCCCAGCTGCTCGCGTACTGCCC
ACACCTTCAAGAGCTGGTGTGAATGATGATGGATGGGGTGTAGATGCCCCTCCCGTGACTCGCACCCAATTGGAA
AAGGTACAATCGGCTTACCAGCCCACTAGAGTGAACCTACAAGAACTCAAGGCAAACCCCACAGGGAGTCGCCAA
CCTGCCGCTACTGCATCGGATGATTCTAGCGATGTTGTTAGAGGTGGCTACCAGCCAGTGGGTAAAGTCGATATT
GCTGCAATTCGGAAACAAGCTGCCGCATCTGGTCAGCTGAAAGATGAGCGCCCCGCAATTATCAAGGGCTCTTAT
GAGCCCATTGGCAAAGTCGACATCGCTGCTATTCGAGCCAGAGCACAGAAGCCGGAAGCCAATGACAACGTCCCA
TCGAGCACTGCATTCAACCAACAGCCAACAACGTTGCCCGAGCGACCTGCGCCCTCTACTGCCGCGGAGCGTTTG
ACCACCCTACCCAAGCCAAGGGTTGCCAACAAGTTTGGCTCTAGCCCCTCCTTCCCTGGAACAAAGCCACCCCTC
CCAGTTGGTCTCGGGCCTAAGCCAACCACGAGCGCGCCGATTGGAACTGCAAGCCGAACTTTTGCTGATGAGGGA
GGCAAGACACCCGCTCAAATTTGGGCAGAGCGTAAAGCCAAGGAGCGCGGAGTCGCCCCGTCATCTGGAACCACT
GAGCCTACCTCTACTCCTGCCCCGATTCAAAGCCAACCTAGTGGCCAAAGCGAGTGGAGAAGCTCCTATGCGGGC
AAGTCCTGGGCTCCCGTTCAAACTGCACAGGAAAAATCATACGATCCTGAGCAACCTGTTGATGCAAAGGCCAAT
GACCAACAAGAGGATAAACCACAACCTCACGTGAGTGCTATTCGTGACCAGTTCGCTCAGGACACGCCCACACCC
GCGCCTGCGCCACTCGCTCCTCCTGCTCCACCTGTTCCGCAGGCCAGTCGCCCTGTTCCTGTACCCGGGCTATCC
TCTGGACCCGTCGAGTCTGAGCCTGAGCATGACGCCCAGCAGGCTCTTCCTACTCCACCACCGCAGCCTCCTCGC
TCCCCGACACCTCCCACCCCGGAGCGTGAGAGCTCGCCGATCCAGATTGCCATGCCGGTTGGCCGCGGCACTGCC
GACAGTATTGCGGATGCACACGAGGAACAATATTCCCCTCCCCCTGCTATGCCTGTTCGGAGCCTCCAAGAGGCC
GTTCCCGACGAGAGGGAAATTGAGGATGATTCTCACGACCTAGGCCGCGCTGCGGCCGAGGCAACCGCTCCTCAG
CAGCCCGAGCAGCCCCAAGGCGGACCGCGAGCCCAAATCCAGTACGACTACGAGAAGGCCGAGGATAATGAGATT
GAATTGCGAGAGGGAGAATATGTGACCGACATTGAAATGGTCGACGAGGATTGGTGGGTGGGTGTCAATACTCAG
GGTGAGCGTGGTCTCTTCCCCGCCAACTATGTGGAGATTGTGGAAGACACAGAACCTGCGTCACACGTACCGGCC
GCTTCCGACCATTATGAAGCGGAGCCAGAGCCAGAGCCTGCTGCTGCCCCCGTCCCGGCGGCACCCACCCCTGTC
GCTGCCGCTGCACCATCAGTGGCTACCCCAAGCTCCAACGGTGTCACGGCCACAGCTTTGTATGACTATGAAGCC
GCCGAGGATAACGAGATCGGTTTCCCTGAAGATGCAAAGATCTCCAACGTGGAATTCCCCGATGACGACTGGTGG
CTTGGTGAGTACAATGGCAAACAAGGTCTATTCCCTGCCAACTATGTTCGCTTGGACGAATGA
Transcript >Pro_DTO377G3_2|g8909.t1
ATGAAGCATGTGCATGTATTGGCACATTCAACCCCGCTGCTTTTATCCTTTTTGCCCGATATTGTAACAAAAGAA
AAAGCTACCCCTCCTCCCACGTGGACACATCTGAAACTTGACAAGCTTTCCCTTCCTTCTCCCCGCCTATTCGCC
GGAAAGTCATGGCTTCTCTCAATCTCTCGTCCAATGGCCCTTCGATATCAAAAAGTTATCAGACAGTGTGCCTTC
CAGCAAGATGGAGGTAAGGAGAGTGTCCTTAAGGTCCAGAGCACCGGAGAGGGTGAATTGGCGGATCTCATCGAG
GAATTTTCCGAAGGACGGGTGCAATTCGCCTATGTGAAGGTGACGGATTCCAACACCGGTCTTCCCAAAAACGTT
CTCATTGGCTGGTGTGGAGAAGGTGTGCCGGAACGAACAAAGGGTTACTTTACTAGCCACCTGGCTGCAGTTGCC
AAGTTCCTTCATGGATACCATGTGCAGATCACAGCCCGAGCAGATGGGGATCTAACCCCCGAGGGAATCGTCCAG
CGGGTGGCAGATTCCTCCGGCTCTAAGTATTCAGTAGGCGAGGCCTCAGCCCGGGCCCCAGCCCCCCGGCCTGCC
GTGGCTAGCAAGCCTGCTTTCACACCGACTCGATCTGGGGGCATCACTCCCAGCCCAGCTGCTCGCGTACTGCCC
ACACCTTCAAGAGCTGGTGTGAATGATGATGGATGGGGTGTAGATGCCCCTCCCGTGACTCGCACCCAATTGGAA
AAGGTACAATCGGCTTACCAGCCCACTAGAGTGAACCTACAAGAACTCAAGGCAAACCCCACAGGGAGTCGCCAA
CCTGCCGCTACTGCATCGGATGATTCTAGCGATGTTGTTAGAGGTGGCTACCAGCCAGTGGGTAAAGTCGATATT
GCTGCAATTCGGAAACAAGCTGCCGCATCTGGTCAGCTGAAAGATGAGCGCCCCGCAATTATCAAGGGCTCTTAT
GAGCCCATTGGCAAAGTCGACATCGCTGCTATTCGAGCCAGAGCACAGAAGCCGGAAGCCAATGACAACGTCCCA
TCGAGCACTGCATTCAACCAACAGCCAACAACGTTGCCCGAGCGACCTGCGCCCTCTACTGCCGCGGAGCGTTTG
ACCACCCTACCCAAGCCAAGGGTTGCCAACAAGTTTGGCTCTAGCCCCTCCTTCCCTGGAACAAAGCCACCCCTC
CCAGTTGGTCTCGGGCCTAAGCCAACCACGAGCGCGCCGATTGGAACTGCAAGCCGAACTTTTGCTGATGAGGGA
GGCAAGACACCCGCTCAAATTTGGGCAGAGCGTAAAGCCAAGGAGCGCGGAGTCGCCCCGTCATCTGGAACCACT
GAGCCTACCTCTACTCCTGCCCCGATTCAAAGCCAACCTAGTGGCCAAAGCGAGTGGAGAAGCTCCTATGCGGGC
AAGTCCTGGGCTCCCGTTCAAACTGCACAGGAAAAATCATACGATCCTGAGCAACCTGTTGATGCAAAGGCCAAT
GACCAACAAGAGGATAAACCACAACCTCACGTGAGTGCTATTCGTGACCAGTTCGCTCAGGACACGCCCACACCC
GCGCCTGCGCCACTCGCTCCTCCTGCTCCACCTGTTCCGCAGGCCAGTCGCCCTGTTCCTGTACCCGGGCTATCC
TCTGGACCCGTCGAGTCTGAGCCTGAGCATGACGCCCAGCAGGCTCTTCCTACTCCACCACCGCAGCCTCCTCGC
TCCCCGACACCTCCCACCCCGGAGCGTGAGAGCTCGCCGATCCAGATTGCCATGCCGGTTGGCCGCGGCACTGCC
GACAGTATTGCGGATGCACACGAGGAACAATATTCCCCTCCCCCTGCTATGCCTGTTCGGAGCCTCCAAGAGGCC
GTTCCCGACGAGAGGGAAATTGAGGATGATTCTCACGACCTAGGCCGCGCTGCGGCCGAGGCAACCGCTCCTCAG
CAGCCCGAGCAGCCCCAAGGCGGACCGCGAGCCCAAATCCAGTACGACTACGAGAAGGCCGAGGATAATGAGATT
GAATTGCGAGAGGGAGAATATGTGACCGACATTGAAATGGTCGACGAGGATTGGTGGGTGGGTGTCAATACTCAG
GGTGAGCGTGGTCTCTTCCCCGCCAACTATGTGGAGATTGTGGAAGACACAGAACCTGCGTCACACGTACCGGCC
GCTTCCGACCATTATGAAGCGGAGCCAGAGCCAGAGCCTGCTGCTGCCCCCGTCCCGGCGGCACCCACCCCTGTC
GCTGCCGCTGCACCATCAGTGGCTACCCCAAGCTCCAACGGTGTCACGGCCACAGCTTTGTATGACTATGAAGCC
GCCGAGGATAACGAGATCGGTTTCCCTGAAGATGCAAAGATCTCCAACGTGGAATTCCCCGATGACGACTGGTGG
CTTGGTGAGTACAATGGCAAACAAGGTCTATTCCCTGCCAACTATGTTCGCTTGGACGAATGA
Gene >Pro_DTO377G3_2|g8909.t1
ATGAAGCATGTGCATGTATTGGCAGTACGAAGTATCGTATTATAACACCTTTCCCCTAACCTCCCGTCTCTCCTC
TCCACCTTTAGGCTTCATCGTTCTCCTGGACCTTTCTCTCTATATTCCTCTTGATTCTGTACTTATCCTTTTCTT
TGGTGTCGCGATATTCTCATCTTGAAAGCATTCAACCCCGCTGCTTTTATCCTTTTTGCCCGGTCAGTGTTTACA
AATGCCCACCTACGTCAACTCCCTCCTTCTCCTATCTATTCCCCTCCCCGAACTTACATCCCACCCCAACACCAA
CAGTCTGGAGTGCTTTTCGCTGACACTGCATGAGATACAGATATTGTAACAAAAGAAAAAGCTACCCCTCCTCCC
ACGTGGACACATCTGAAACTTGACAAGCTTTCCCTTCCTTCTCCCCGCCTATTCGCCGGAAAGTCATGGCTTCTC
TCAATCTCTCGTCCAATGGCCCTTCGATATCAAAAAGTTATCAGACAGTGGTGAATGCACCACCCCCTTCTGGGA
ACGGAGGGTCTGCGACCTATGGCCAATGGGCTGTCTACTCAGTTTCTACCCCGCTTGTTAGTGCCTTCCAGCAAG
ATGGAGGTAAGGAGAGTGTCCTTAAGGTCCAGAGCACCGGAGGTTAGTAGTCCTTTTTACCAACCAAGCCCATTA
TCTTATATTAACCAATCGTGCTGCAGAGGGTGAATTGGCGGATCTCATCGAGGAATTTTCCGAAGGACGGGTGCA
ATTCGCCTATGTGAAGGTGACGGATTCCAACACCGGTCTTCCCAAAAACGTTCTCATTGGCTGGTGTGGAGAAGG
TGTGCCGGAACGAACAAAGGGTTACTTTACTAGCCACCTGGCTGCAGTTGCCAAGTTCCTTCATGTGAGGAGTTT
CCTTCCCCTGATGCAACTGTCGCGGTGAAACTGACTTGGCTGGATAGGGATACCATGTGCAGATCACAGCCCGAG
CAGATGGGGATCTAACCCCCGAGGGAATCGTCCAGCGGGTGGCAGATTCCTCCGGCTCTAAGTATTCAGTAGGCG
AGGCCTCAGCCCGGGCCCCAGCCCCCCGGCCTGCCGTGGCTAGCAAGCCTGCTTTCACACCGACTCGATCTGGGG
GCATCACTCCCAGCCCAGCTGCTCGCGTACTGCCCACACCTTCAAGAGCTGGTGTGAATGATGATGGATGGGGTG
TAGATGCCCCTCCCGTGACTCGCACCCAATTGGAAAAGGTACAATCGGCTTACCAGCCCACTAGAGTGAACCTAC
AAGAACTCAAGGCAAACCCCACAGGGAGTCGCCAACCTGCCGCTACTGCATCGGATGATTCTAGCGATGTTGTTA
GAGGTGGCTACCAGCCAGTGGGTAAAGTCGATATTGCTGCAATTCGGAAACAAGCTGCCGCATCTGGTCAGCTGA
AAGATGAGCGCCCCGCAATTATCAAGGGCTCTTATGAGCCCATTGGCAAAGTCGACATCGCTGCTATTCGAGCCA
GAGCACAGAAGCCGGAAGCCAATGACAACGTCCCATCGAGCACTGCATTCAACCAACAGCCAACAACGTTGCCCG
AGCGACCTGCGCCCTCTACTGCCGCGGAGCGTTTGACCACCCTACCCAAGCCAAGGGTTGCCAACAAGTTTGGCT
CTAGCCCCTCCTTCCCTGGAACAAAGCCACCCCTCCCAGTTGGTCTCGGGCCTAAGCCAACCACGAGCGCGCCGA
TTGGAACTGCAAGCCGAACTTTTGCTGATGAGGGAGGCAAGACACCCGCTCAAATTTGGGCAGAGCGTAAAGCCA
AGGAGCGCGGAGTCGCCCCGTCATCTGGAACCACTGAGCCTACCTCTACTCCTGCCCCGATTCAAAGCCAACCTA
GTGGCCAAAGCGAGTGGAGAAGCTCCTATGCGGGCAAGTCCTGGGCTCCCGTTCAAACTGCACAGGAAAAATCAT
ACGATCCTGAGCAACCTGTTGATGCAAAGGCCAATGACCAACAAGAGGATAAACCACAACCTCACGTGAGTGCTA
TTCGTGACCAGTTCGCTCAGGACACGCCCACACCCGCGCCTGCGCCACTCGCTCCTCCTGCTCCACCTGTTCCGC
AGGCCAGTCGCCCTGTTCCTGTACCCGGGCTATCCTCTGGACCCGTCGAGTCTGAGCCTGAGCATGACGCCCAGC
AGGCTCTTCCTACTCCACCACCGCAGCCTCCTCGCTCCCCGACACCTCCCACCCCGGAGCGTGAGAGCTCGCCGA
TCCAGATTGCCATGCCGGTTGGCCGCGGCACTGCCGACAGTATTGCGGATGCACACGAGGAACAATATTCCCCTC
CCCCTGCTATGCCTGTTCGGAGCCTCCAAGAGGCCGTTCCCGACGAGAGGGAAATTGAGGATGATTCTCACGACC
TAGGCCGCGCTGCGGCCGAGGCAACCGCTCCTCAGCAGCCCGAGCAGCCCCAAGGCGGACCGCGAGCCCAAATCC
AGTACGACTACGAGAAGGCCGAGGATAATGAGATTGAATTGCGAGAGGGAGAATATGTGACCGACATTGAAATGG
TCGACGAGGATTGGTGGGTGGGTGTCAATACTCAGGGTGAGCGTGGTCTCTTCCCCGCCAACTATGTGGAGATTG
TGGAAGACACAGAACCTGCGTCACACGTACCGGCCGCTTCCGACCATTATGAAGCGGAGCCAGAGCCAGAGCCTG
CTGCTGCCCCCGTCCCGGCGGCACCCACCCCTGTCGCTGCCGCTGCACCATCAGTGGCTACCCCAAGCTCCAACG
GTGTCACGGCCACAGCTTTGTATGACTATGAAGCCGCCGAGGATAACGAGATCGGTTTCCCTGAAGATGCAAAGA
TCTCCAACGTGGTAAGTGGAGCAATCCCTGTTTTTCTCGGCTTTGCCCCATCACTATCTACAGTACTAACCCGGT
TGTAGGAATTCCCCGATGACGACTGGTGGCTTGGTGAGTACAATGGCAAACAAGGTCTATTCCCTGCCAACTATG
TTCGCTTGGACGAATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail