Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g8897.t1
Gene name
Locationscaffold_38:140237..144767
Strand+
Gene length (bp)4530
Transcript length (bp)4470
Coding sequence length (bp)4470
Protein length (aa) 1490

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF15902 Sortilin-Vps10 Sortilin, neurotensin receptor 3, 1.7E-132 62 516
PF15902 Sortilin-Vps10 Sortilin, neurotensin receptor 3, 6.5E-141 734 1182
PF15901 Sortilin_C Sortilin, neurotensin receptor 3, C-terminal 1.8E-46 521 681
PF15901 Sortilin_C Sortilin, neurotensin receptor 3, C-terminal 3.0E-45 1184 1345

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 24 0.45

Transmembrane Domains

Domain # Start End Length
1 1361 1383 22
2 1409 1431 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g8897.t1
MIPRWLLLILSLLLVWTSQPAAAKGNEPNVVTHELNAPPADLFYFHGTNTILYRDKNTLTAHVSFDGGEKWEIVK
GKDGTIEGAVELIWRHPFDVNRAYILGESGKHWITTDQAKSWKSFQVDVLPFASMRSFPLEFNGWDPKKVIFMGL
DCTILGCMPQAFYTVDDFENVQPLREMTLQCMWAASRPQFALDLDMPKSIGDRILCVVPGLKGPFEHTRTERLIY
SDKFFKDDADGTESKLDHGKPMSGISLQIRSVSKYIVARLQSRGTQEQALYVSDDSNVWHRAEFGKRRIEEDAYT
ILESTNYSIQIDVQTTWHDNRMGSLFTSNSNGTYFTKNIEHTNEDLNGLVDFEKVTGIQGITIVNTVKNWEEAEN
SDAIKKKLISSISFDDGRTFQPLKADKDELHLHSMTTYAALHEMPFPDHRMFSSPAPGLTMGVGNTGGHLEDYSD
GDLYVSDNAGLTWRRALKGPHRYEFGDQGGVIAAVLDGSKTDKVQFSIDHGKEWESIDLKQKIRPLFLISTPDST
SLKFLLVGISDDDTKVLMFFIDFDGLHERQCGTDDLEEWTARLDEKGEPDCLMGQKQFFYRRKANADCFIKKEFA
ISGPEFKPCKCSAEDFECDYNFVRSEDRKECLPAVPLTPPAGKCTEPSDKYMGPSGWRLIPGNSCIREGGENLDR
QIERSCSNVTGPAPITDGKPRAEKPQIISAKDTNYFYLERQASNNGVDETIMMLTDKYELHISRDHGRNWKQVHA
DEKFTEMVPHPYFSDAAFFLTNSKKVYYTINHGDSFHFFEAPSVPTKENIRALAFHEKFQDSLIWIGHKDCEGKN
CRSQAYVTDKRGASWDPMLIGVADGGCNFGYHEGRNNSEKLVICEQYKDEEKNNNRQLVISDDYFSTMDVKFENI
ARSATKNGFVVVAWYEGDQKEYLNASVSVDGRTYANVHFPFNIKVPQYTVLPSSPHALFLLVMVNGGDERSFGSL
VKSNSNGTYFVQSLEGLNVNDRGYTDYDELQGLEGVAIANVVSNREEVLSKGAAKKLRTMITHNDGGQWMLLAPP
SQDVDGKKFGCSVTEGKGTEKCALHFHGYTERRDYRDTLYSGSAIGLMLALGNVGEHLTSAAEADTYLTRDGGIS
WTQVKKGQYMWEFGAAGSVIVLVSDRKATKVVHYTLDEGASWHEFQFAEKELVIDDISTVPSDTSKNFLLWGMDE
GKRVTITLDFSGIWSRDCNDDEKDYYNWAPSHPFQEENCLFGHVEEYHRKRPTAECWNSWREPHLHSIGRNCTCT
RADFECDYNYEIQSDGSCGLVPGLQPQDHIAQCAQDPEKVEYWEPTGYRRIPQTTCEGGLLLDQDVSKPCPSKEK
EYQKKHGISGTGLFFAIVTPIVAAVAVGWYVYTHWDGKFGQIRLGDTGVASHSWLSRDSVLVVVPVAIIAGIVAV
AQSLPLLVKSLARSASGLFGRRGAQRPYATRGSFAARRGDYSSVVDDEDELLGADDFDDEEEQA*
Coding >Pro_DTO377G3_2|g8897.t1
ATGATCCCACGGTGGCTGCTGCTCATACTGAGCCTGCTGCTGGTATGGACGTCACAGCCAGCAGCGGCAAAGGGA
AATGAACCGAACGTTGTGACCCATGAACTCAATGCTCCGCCCGCCGACCTTTTCTACTTTCACGGCACAAACACC
ATCCTCTACCGTGACAAGAATACCCTCACCGCGCATGTCTCCTTCGATGGCGGAGAGAAATGGGAGATCGTTAAA
GGCAAGGATGGAACCATAGAGGGCGCCGTCGAGTTGATTTGGAGACATCCGTTCGACGTCAACCGCGCGTACATT
CTTGGCGAGAGTGGCAAGCACTGGATCACGACCGACCAGGCCAAATCGTGGAAATCCTTCCAGGTGGACGTACTG
CCATTCGCATCGATGCGCTCATTCCCATTGGAGTTCAATGGCTGGGACCCGAAAAAAGTTATATTCATGGGTCTG
GACTGCACTATCCTTGGCTGCATGCCCCAGGCGTTTTATACCGTCGACGACTTCGAAAATGTCCAACCGTTGCGC
GAGATGACGCTGCAGTGTATGTGGGCTGCGAGCCGCCCGCAGTTCGCGTTGGACCTAGACATGCCGAAATCGATA
GGAGACCGGATTCTCTGCGTGGTCCCTGGGTTGAAGGGGCCTTTTGAGCATACCCGTACAGAACGCTTGATATAT
TCCGATAAATTTTTCAAAGACGATGCGGATGGCACCGAGTCCAAATTGGACCACGGTAAACCGATGAGCGGTATC
AGTCTTCAAATCCGCTCCGTGTCTAAGTATATCGTGGCGCGCCTTCAATCACGCGGCACCCAGGAGCAGGCTTTA
TACGTCAGTGACGACTCGAATGTGTGGCACCGCGCGGAATTTGGCAAGCGCCGCATTGAAGAGGATGCCTATACT
ATCTTGGAAAGCACCAACTACAGCATCCAGATCGACGTGCAAACTACCTGGCATGATAACCGGATGGGAAGTCTT
TTCACGTCCAACTCCAATGGCACCTACTTTACGAAGAACATCGAGCACACGAACGAGGACCTGAATGGCTTGGTC
GATTTTGAGAAAGTCACGGGTATCCAGGGTATCACGATCGTCAACACGGTCAAGAACTGGGAGGAAGCTGAGAAT
TCTGATGCAATCAAAAAGAAGCTTATCAGCAGTATTAGTTTTGACGATGGAAGGACATTCCAGCCTCTCAAGGCT
GATAAAGACGAGCTACACCTCCATTCCATGACCACCTACGCCGCTCTACACGAGATGCCCTTCCCAGATCACCGG
ATGTTCTCAAGCCCCGCTCCGGGCTTGACCATGGGCGTTGGTAACACTGGAGGTCATCTTGAAGACTACTCGGAT
GGTGATCTTTACGTTTCAGACAACGCGGGTCTCACCTGGCGTCGCGCGCTCAAGGGCCCGCACCGGTACGAGTTT
GGCGACCAGGGAGGTGTGATTGCGGCCGTCTTAGATGGCAGCAAGACGGATAAGGTCCAATTTTCTATCGACCAC
GGGAAAGAGTGGGAGTCGATTGATCTGAAGCAGAAGATCAGGCCTCTGTTCCTGATCTCAACGCCGGATTCGACC
AGCCTCAAGTTCCTGCTTGTTGGCATCTCCGATGATGACACCAAGGTCCTCATGTTCTTCATAGACTTCGATGGC
CTCCACGAGCGCCAGTGTGGCACCGATGACCTCGAAGAGTGGACTGCGCGTTTAGATGAAAAGGGCGAGCCGGAT
TGTCTGATGGGTCAAAAGCAGTTCTTCTACCGCCGCAAGGCAAACGCGGATTGCTTCATCAAGAAGGAGTTTGCC
ATTAGCGGCCCTGAATTCAAACCCTGCAAGTGTTCCGCTGAAGACTTTGAATGCGACTACAACTTTGTTCGCAGC
GAGGACCGCAAGGAGTGTCTACCAGCTGTCCCGCTGACACCCCCGGCTGGCAAGTGCACTGAGCCCAGCGATAAG
TACATGGGGCCCTCTGGATGGAGACTCATCCCCGGTAACTCATGTATCCGCGAAGGCGGCGAGAATCTCGACCGC
CAGATTGAGCGCTCCTGCTCGAATGTCACGGGGCCTGCTCCCATTACCGATGGCAAACCTCGCGCAGAAAAGCCA
CAGATCATCTCTGCCAAAGATACAAACTACTTCTATCTCGAACGACAGGCCAGTAACAACGGCGTTGATGAGACT
ATCATGATGCTCACAGACAAATATGAGCTGCATATCTCGCGTGACCATGGCCGGAACTGGAAGCAGGTCCACGCG
GATGAGAAGTTTACGGAAATGGTCCCGCATCCTTACTTCAGTGATGCAGCTTTCTTCCTCACCAACAGCAAGAAG
GTGTACTACACTATCAATCATGGCGATTCTTTCCACTTCTTCGAGGCTCCTAGTGTGCCGACCAAGGAGAACATC
CGCGCACTCGCTTTCCATGAGAAGTTCCAGGACTCCCTTATCTGGATTGGTCACAAGGACTGTGAGGGGAAGAAC
TGTCGCTCACAGGCGTACGTCACCGACAAGCGAGGCGCTAGTTGGGACCCGATGCTTATTGGAGTCGCCGACGGC
GGTTGCAACTTTGGATATCACGAGGGCCGCAACAACAGTGAAAAACTAGTGATTTGCGAGCAGTATAAAGATGAG
GAAAAGAACAATAACCGACAGCTGGTTATCAGTGATGACTATTTCTCTACTATGGACGTCAAGTTTGAGAACATC
GCCCGTTCTGCTACCAAGAACGGGTTCGTCGTCGTCGCCTGGTACGAAGGAGACCAGAAGGAATACCTGAATGCC
AGCGTCAGCGTCGACGGTCGCACTTACGCGAATGTGCACTTCCCTTTCAACATCAAGGTTCCTCAGTATACCGTC
CTGCCTAGCTCTCCGCACGCATTGTTCCTTCTTGTGATGGTTAACGGGGGCGATGAACGCAGCTTCGGCTCTTTG
GTCAAGAGTAACAGTAACGGCACCTACTTTGTCCAGAGTCTCGAGGGGCTCAACGTTAACGACCGCGGCTACACG
GACTACGATGAGTTGCAAGGCCTCGAGGGCGTGGCCATTGCCAATGTGGTTTCAAATCGGGAAGAAGTGCTGAGC
AAGGGTGCCGCCAAGAAGCTACGCACTATGATTACCCACAACGACGGTGGTCAGTGGATGCTTCTGGCTCCCCCG
AGTCAAGATGTCGATGGCAAGAAATTCGGCTGCTCCGTTACGGAGGGCAAGGGCACTGAGAAATGCGCTCTCCAT
TTCCACGGCTACACGGAACGCCGCGATTATCGCGACACCCTCTACTCGGGCTCCGCCATCGGCCTGATGCTCGCG
CTCGGAAACGTCGGTGAACATCTCACTAGCGCAGCTGAAGCCGACACATACCTCACCAGGGACGGCGGCATCTCC
TGGACGCAAGTCAAGAAGGGACAATATATGTGGGAATTCGGCGCAGCAGGCTCGGTAATCGTGCTCGTCAGCGAC
CGGAAGGCCACCAAGGTCGTACACTACACGCTCGACGAGGGCGCGAGCTGGCACGAGTTCCAGTTTGCCGAAAAA
GAACTGGTCATTGACGATATATCCACCGTGCCATCAGACACATCGAAAAACTTCCTGCTCTGGGGCATGGACGAG
GGCAAGCGTGTCACCATCACGCTTGACTTCAGCGGTATCTGGAGCCGCGACTGTAACGACGATGAGAAAGATTAC
TATAACTGGGCCCCCAGTCATCCCTTCCAGGAAGAAAATTGTCTCTTCGGCCATGTCGAGGAGTACCACCGCAAG
AGACCTACTGCTGAGTGCTGGAATTCCTGGCGTGAGCCACATCTCCACAGCATCGGCCGGAACTGCACGTGCACC
CGGGCTGATTTCGAATGTGACTACAACTACGAAATCCAATCCGACGGCAGCTGCGGCCTCGTCCCAGGTCTCCAA
CCCCAAGACCACATCGCACAATGCGCCCAAGATCCCGAAAAGGTTGAATACTGGGAACCCACCGGCTACCGTCGG
ATTCCGCAGACAACCTGCGAAGGCGGCCTCCTACTAGACCAGGACGTGTCAAAACCGTGCCCATCCAAAGAAAAA
GAGTACCAAAAGAAGCACGGCATCAGCGGAACAGGTCTATTCTTCGCGATCGTGACACCCATCGTCGCCGCCGTC
GCCGTAGGCTGGTACGTGTACACGCACTGGGACGGCAAATTCGGCCAGATCCGGCTGGGCGATACCGGCGTCGCA
TCGCATAGCTGGTTATCCAGGGACTCGGTGCTGGTCGTGGTACCTGTGGCGATTATCGCGGGTATTGTTGCAGTT
GCGCAGTCTTTGCCGTTACTTGTTAAGAGTCTGGCGCGGAGCGCGTCTGGTCTGTTTGGCAGGCGTGGGGCGCAG
AGACCTTATGCTACGCGTGGGTCGTTTGCGGCGAGGAGAGGGGATTATTCTTCTGTTGTTGATGATGAGGATGAG
CTGCTTGGGGCTGATGATTTTGACGATGAGGAGGAGCAGGCTTAG
Transcript >Pro_DTO377G3_2|g8897.t1
ATGATCCCACGGTGGCTGCTGCTCATACTGAGCCTGCTGCTGGTATGGACGTCACAGCCAGCAGCGGCAAAGGGA
AATGAACCGAACGTTGTGACCCATGAACTCAATGCTCCGCCCGCCGACCTTTTCTACTTTCACGGCACAAACACC
ATCCTCTACCGTGACAAGAATACCCTCACCGCGCATGTCTCCTTCGATGGCGGAGAGAAATGGGAGATCGTTAAA
GGCAAGGATGGAACCATAGAGGGCGCCGTCGAGTTGATTTGGAGACATCCGTTCGACGTCAACCGCGCGTACATT
CTTGGCGAGAGTGGCAAGCACTGGATCACGACCGACCAGGCCAAATCGTGGAAATCCTTCCAGGTGGACGTACTG
CCATTCGCATCGATGCGCTCATTCCCATTGGAGTTCAATGGCTGGGACCCGAAAAAAGTTATATTCATGGGTCTG
GACTGCACTATCCTTGGCTGCATGCCCCAGGCGTTTTATACCGTCGACGACTTCGAAAATGTCCAACCGTTGCGC
GAGATGACGCTGCAGTGTATGTGGGCTGCGAGCCGCCCGCAGTTCGCGTTGGACCTAGACATGCCGAAATCGATA
GGAGACCGGATTCTCTGCGTGGTCCCTGGGTTGAAGGGGCCTTTTGAGCATACCCGTACAGAACGCTTGATATAT
TCCGATAAATTTTTCAAAGACGATGCGGATGGCACCGAGTCCAAATTGGACCACGGTAAACCGATGAGCGGTATC
AGTCTTCAAATCCGCTCCGTGTCTAAGTATATCGTGGCGCGCCTTCAATCACGCGGCACCCAGGAGCAGGCTTTA
TACGTCAGTGACGACTCGAATGTGTGGCACCGCGCGGAATTTGGCAAGCGCCGCATTGAAGAGGATGCCTATACT
ATCTTGGAAAGCACCAACTACAGCATCCAGATCGACGTGCAAACTACCTGGCATGATAACCGGATGGGAAGTCTT
TTCACGTCCAACTCCAATGGCACCTACTTTACGAAGAACATCGAGCACACGAACGAGGACCTGAATGGCTTGGTC
GATTTTGAGAAAGTCACGGGTATCCAGGGTATCACGATCGTCAACACGGTCAAGAACTGGGAGGAAGCTGAGAAT
TCTGATGCAATCAAAAAGAAGCTTATCAGCAGTATTAGTTTTGACGATGGAAGGACATTCCAGCCTCTCAAGGCT
GATAAAGACGAGCTACACCTCCATTCCATGACCACCTACGCCGCTCTACACGAGATGCCCTTCCCAGATCACCGG
ATGTTCTCAAGCCCCGCTCCGGGCTTGACCATGGGCGTTGGTAACACTGGAGGTCATCTTGAAGACTACTCGGAT
GGTGATCTTTACGTTTCAGACAACGCGGGTCTCACCTGGCGTCGCGCGCTCAAGGGCCCGCACCGGTACGAGTTT
GGCGACCAGGGAGGTGTGATTGCGGCCGTCTTAGATGGCAGCAAGACGGATAAGGTCCAATTTTCTATCGACCAC
GGGAAAGAGTGGGAGTCGATTGATCTGAAGCAGAAGATCAGGCCTCTGTTCCTGATCTCAACGCCGGATTCGACC
AGCCTCAAGTTCCTGCTTGTTGGCATCTCCGATGATGACACCAAGGTCCTCATGTTCTTCATAGACTTCGATGGC
CTCCACGAGCGCCAGTGTGGCACCGATGACCTCGAAGAGTGGACTGCGCGTTTAGATGAAAAGGGCGAGCCGGAT
TGTCTGATGGGTCAAAAGCAGTTCTTCTACCGCCGCAAGGCAAACGCGGATTGCTTCATCAAGAAGGAGTTTGCC
ATTAGCGGCCCTGAATTCAAACCCTGCAAGTGTTCCGCTGAAGACTTTGAATGCGACTACAACTTTGTTCGCAGC
GAGGACCGCAAGGAGTGTCTACCAGCTGTCCCGCTGACACCCCCGGCTGGCAAGTGCACTGAGCCCAGCGATAAG
TACATGGGGCCCTCTGGATGGAGACTCATCCCCGGTAACTCATGTATCCGCGAAGGCGGCGAGAATCTCGACCGC
CAGATTGAGCGCTCCTGCTCGAATGTCACGGGGCCTGCTCCCATTACCGATGGCAAACCTCGCGCAGAAAAGCCA
CAGATCATCTCTGCCAAAGATACAAACTACTTCTATCTCGAACGACAGGCCAGTAACAACGGCGTTGATGAGACT
ATCATGATGCTCACAGACAAATATGAGCTGCATATCTCGCGTGACCATGGCCGGAACTGGAAGCAGGTCCACGCG
GATGAGAAGTTTACGGAAATGGTCCCGCATCCTTACTTCAGTGATGCAGCTTTCTTCCTCACCAACAGCAAGAAG
GTGTACTACACTATCAATCATGGCGATTCTTTCCACTTCTTCGAGGCTCCTAGTGTGCCGACCAAGGAGAACATC
CGCGCACTCGCTTTCCATGAGAAGTTCCAGGACTCCCTTATCTGGATTGGTCACAAGGACTGTGAGGGGAAGAAC
TGTCGCTCACAGGCGTACGTCACCGACAAGCGAGGCGCTAGTTGGGACCCGATGCTTATTGGAGTCGCCGACGGC
GGTTGCAACTTTGGATATCACGAGGGCCGCAACAACAGTGAAAAACTAGTGATTTGCGAGCAGTATAAAGATGAG
GAAAAGAACAATAACCGACAGCTGGTTATCAGTGATGACTATTTCTCTACTATGGACGTCAAGTTTGAGAACATC
GCCCGTTCTGCTACCAAGAACGGGTTCGTCGTCGTCGCCTGGTACGAAGGAGACCAGAAGGAATACCTGAATGCC
AGCGTCAGCGTCGACGGTCGCACTTACGCGAATGTGCACTTCCCTTTCAACATCAAGGTTCCTCAGTATACCGTC
CTGCCTAGCTCTCCGCACGCATTGTTCCTTCTTGTGATGGTTAACGGGGGCGATGAACGCAGCTTCGGCTCTTTG
GTCAAGAGTAACAGTAACGGCACCTACTTTGTCCAGAGTCTCGAGGGGCTCAACGTTAACGACCGCGGCTACACG
GACTACGATGAGTTGCAAGGCCTCGAGGGCGTGGCCATTGCCAATGTGGTTTCAAATCGGGAAGAAGTGCTGAGC
AAGGGTGCCGCCAAGAAGCTACGCACTATGATTACCCACAACGACGGTGGTCAGTGGATGCTTCTGGCTCCCCCG
AGTCAAGATGTCGATGGCAAGAAATTCGGCTGCTCCGTTACGGAGGGCAAGGGCACTGAGAAATGCGCTCTCCAT
TTCCACGGCTACACGGAACGCCGCGATTATCGCGACACCCTCTACTCGGGCTCCGCCATCGGCCTGATGCTCGCG
CTCGGAAACGTCGGTGAACATCTCACTAGCGCAGCTGAAGCCGACACATACCTCACCAGGGACGGCGGCATCTCC
TGGACGCAAGTCAAGAAGGGACAATATATGTGGGAATTCGGCGCAGCAGGCTCGGTAATCGTGCTCGTCAGCGAC
CGGAAGGCCACCAAGGTCGTACACTACACGCTCGACGAGGGCGCGAGCTGGCACGAGTTCCAGTTTGCCGAAAAA
GAACTGGTCATTGACGATATATCCACCGTGCCATCAGACACATCGAAAAACTTCCTGCTCTGGGGCATGGACGAG
GGCAAGCGTGTCACCATCACGCTTGACTTCAGCGGTATCTGGAGCCGCGACTGTAACGACGATGAGAAAGATTAC
TATAACTGGGCCCCCAGTCATCCCTTCCAGGAAGAAAATTGTCTCTTCGGCCATGTCGAGGAGTACCACCGCAAG
AGACCTACTGCTGAGTGCTGGAATTCCTGGCGTGAGCCACATCTCCACAGCATCGGCCGGAACTGCACGTGCACC
CGGGCTGATTTCGAATGTGACTACAACTACGAAATCCAATCCGACGGCAGCTGCGGCCTCGTCCCAGGTCTCCAA
CCCCAAGACCACATCGCACAATGCGCCCAAGATCCCGAAAAGGTTGAATACTGGGAACCCACCGGCTACCGTCGG
ATTCCGCAGACAACCTGCGAAGGCGGCCTCCTACTAGACCAGGACGTGTCAAAACCGTGCCCATCCAAAGAAAAA
GAGTACCAAAAGAAGCACGGCATCAGCGGAACAGGTCTATTCTTCGCGATCGTGACACCCATCGTCGCCGCCGTC
GCCGTAGGCTGGTACGTGTACACGCACTGGGACGGCAAATTCGGCCAGATCCGGCTGGGCGATACCGGCGTCGCA
TCGCATAGCTGGTTATCCAGGGACTCGGTGCTGGTCGTGGTACCTGTGGCGATTATCGCGGGTATTGTTGCAGTT
GCGCAGTCTTTGCCGTTACTTGTTAAGAGTCTGGCGCGGAGCGCGTCTGGTCTGTTTGGCAGGCGTGGGGCGCAG
AGACCTTATGCTACGCGTGGGTCGTTTGCGGCGAGGAGAGGGGATTATTCTTCTGTTGTTGATGATGAGGATGAG
CTGCTTGGGGCTGATGATTTTGACGATGAGGAGGAGCAGGCTTAG
Gene >Pro_DTO377G3_2|g8897.t1
ATGATCCCACGGTGGCTGCTGCTCATACTGAGCCTGCTGCTGGTATGGACGTCACAGCCAGCAGCGGCAAAGGGA
AATGAACCGAACGTTGTGACCCATGAACTCAATGCTCCGCCCGCCGACCTTTTCTACTTTCACGGCACAAACACC
ATCCTCTACCGTGACAAGAATACCCTCACCGCGCATGTCTCCTTCGATGGCGGAGAGAAATGGGAGATCGTTAAA
GGCAAGGATGGAACCATAGAGGGCGCCGTCGAGTTGATTTGGAGACATCCGTTCGACGTCAACCGCGCGTACATT
CTTGGCGAGAGTGGCAAGCACTGGATCACGACCGACCAGGCCAAATCGTGGAAATCCTTCCAGGTGGACGTACTG
CCATTCGCATCGATGCGCTCATTCCCATTGGAGTTCAATGGCTGGGACCCGAAAAAAGTTATATTCATGGGTCTG
GACTGCACTATCCTTGGCTGCATGCCCCAGGCGTTTTATACCGTCGACGACTTCGAAAATGTCCAACCGTTGCGC
GAGATGACGCTGCAGTGTATGTGGGCTGCGAGCCGCCCGCAGTTCGCGTTGGACCTAGACATGCCGAAATCGATA
GGAGACCGGATTCTCTGCGTGGTCCCTGGGTTGAAGGGGCCTTTTGAGCATACCCGTACAGAACGCTTGATATAT
TCCGATAAATTTTTCAAAGACGATGCGGATGGCACCGAGTCCAAATTGGACCACGGTAAACCGATGAGCGGTATC
AGTCTTCAAATCCGCTCCGTGTCTAAGTATATCGTGGCGCGCCTTCAATCACGCGGCACCCAGGAGCAGGCTTTA
TACGTCAGTGACGACTCGAATGTGTGGCACCGCGCGGAATTTGGCAAGCGCCGCATTGAAGAGGATGCCTATACT
ATCTTGGAAAGCACCAACTACAGCATCCAGATCGACGTGCAAACTACCTGGCATGATAACCGGATGGGAAGTCTT
TTCACGTCCAACTCCAATGGCACCTACTTTACGAAGAACATCGAGCACACGAACGAGGACCTGAATGGCTTGGTC
GATTTTGAGAAAGTCACGGGTATCCAGGGTATCACGATCGTCAACACGGTCAAGAACTGGGAGGAAGCTGAGAAT
TCTGATGCAATCAAAAAGAAGCTTATCAGCAGTATTAGTTTTGACGATGGAAGGACATTCCAGCCTCTCAAGGCT
GATAAAGACGAGCTACACCTCCATTCCATGACCACCTACGCCGCTCTACACGAGATGCCCTTCCCAGATCACCGG
ATGTTCTCAAGCCCCGCTCCGGGCTTGACCATGGGCGTTGGTAACACTGGAGGTCATCTTGAAGACTACTCGGAT
GGTGATCTTTACGTTTCAGACAACGCGGGTCTCACCTGGCGTCGCGCGCTCAAGGGCCCGCACCGGTACGAGTTT
GGCGACCAGGGAGGTGTGATTGCGGCCGTCTTAGATGGCAGCAAGACGGATAAGGTCCAATTTTCTATCGACCAC
GGGAAAGAGTGGGAGTCGATTGATCTGAAGCAGAAGATCAGGCCTCTGTTCCTGATCTCAACGCCGGATTCGACC
AGCCTCAAGTTCCTGCTTGTTGGCATCTCCGATGATGACACCAAGGTCCTCATGTTCTTCATAGACTTCGATGGC
CTCCACGAGCGCCAGTGTGGCACCGATGACCTCGAAGAGTGGACTGCGCGTTTAGATGAAAAGGGCGAGCCGGAT
TGTCTGATGGGTCAAAAGCAGTTCTTCTACCGCCGCAAGGCAAACGCGGATTGCTTCATCAAGAAGGAGTTTGCC
ATTAGCGGCCCTGAATTCAAACCCTGCAAGTGTTCCGCTGAAGACTTTGAATGCGACTACAACTTTGTTCGCAGC
GAGGACCGCAAGGAGTGTCTACCAGCTGTCCCGCTGACACCCCCGGCTGGCAAGTGCACTGAGCCCAGCGATAAG
TACATGGGGCCCTCTGGATGGAGACTCATCCCCGGTAACTCATGTATCCGCGAAGGCGGCGAGAATCTCGACCGC
CAGATTGAGCGCTCCTGCTCGAATGTCACGGGGCCTGCTCCCATTACCGATGGCAAACCTCGCGCAGAAAAGCCA
CAGATCATCTCTGCCAAAGATACAAACTACTTCTATCTCGAACGACAGGCCAGTAACAACGGCGTTGATGAGACT
ATCATGATGCTCACAGACAAATATGAGCTGCATATCTCGCGTGACCATGGCCGGAACTGGAAGCAGGTCCACGCG
GATGAGAAGTTTACGGAAATGGTCCCGCATCCTTACTTCAGTGATGCAGCTTTCTTCCTCACCAACAGCAAGAAG
GTGTACTACACTATCAATCATGGCGATTCTTTCCACTTCTTCGAGGCTCCTAGTGTGCCGACCAAGGAGAACATC
CGCGCACTCGCTTTCCATGAGAAGTTCCAGGACTCCCTTATCTGGATTGGTCACAAGGACTGTGAGGGGAAGAAC
TGTCGCTCACAGGCGTACGTCACCGACAAGCGAGGCGCTAGTTGGGACCCGATGCTTATTGGAGTCGCCGACGGC
GGTTGCAACTTTGGATATCACGAGGGCCGCAACAACAGTGAAAAACTAGTGATTTGCGAGCAGTATAAAGATGAG
GAAAAGAACAATAACCGACAGCTGGTTATCAGTGATGACTATTTCTCTACTATGGACGTCAAGTTTGAGAACATC
GCCCGTTCTGCTACCAAGAACGGGTTCGTCGTCGTCGCCTGGTACGAAGGAGACCAGAAGGAATACCTGAATGCC
AGCGTCAGCGTCGACGGTCGCACTTACGCGAATGTGCACTTCCCTTTCAACATCAAGGTTCCTCAGTATACCGTC
CTGCCTAGCTCTCCGCACGCATTGTTCCTTCTTGTGATGGTTAACGGGGGCGATGAACGCAGCTTCGGCTCTTTG
GTCAAGAGTAACAGTAACGGCACCTACTTTGTCCAGAGTCTCGAGGGGCTCAACGTTAACGACCGCGGCTACACG
GACTACGATGAGTTGCAAGGCCTCGAGGGCGTGGCCATTGCCAATGTGGTTTCAAATCGGGAAGAAGTGCTGAGC
AAGGGTGCCGCCAAGAAGCTACGCACTATGATTACCCACAACGACGGTGGTCAGTGGATGCTTCTGGCTCCCCCG
AGTCAAGATGTCGATGGCAAGAAATTCGGCTGCTCCGTTACGGAGGGCAAGGGCACTGAGAAATGCGCTCTCCAT
TTCCACGGCTACACGGAACGCCGCGATTATCGCGACACCCTCTACTCGGGCTCCGCCATCGGCCTGATGCTCGCG
CTCGGAAACGTCGGTGAACATCTCACTAGCGCAGCTGAAGCCGACACATACCTCACCAGGGACGGCGGCATCTCC
TGGACGCAAGTCAAGAAGGGACAATATATGTGGGAATTCGGCGCAGCAGGCTCGGTAATCGTGCTCGTCAGCGAC
CGGAAGGCCACCAAGGTCGTACACTACACGCTCGACGAGGGCGCGAGCTGGCACGAGTTCCAGTTTGCCGAAAAA
GAACTGGTCATTGACGATATATCCACCGTGCCATCAGACACATCGAAAAACTTCCTGCTCTGGGGCATGGACGAG
GGCAAGCGTGTCACCATCACGCTTGACTTCAGCGGTATCTGGAGCCGCGACTGTAACGACGATGAGAAAGATTAC
TATAACTGGGCCCCCAGTCATCCCTTCCAGGAAGAAAATTGTCTCTTCGGCCATGTCGAGGAGTACCACCGCAAG
AGACCTACTGCTGAGTGCTGGAATTCCTGGCGTGAGCCACATCTCCACAGCATCGGCCGGAACTGCACGTGCACC
CGGGCTGATTTCGAATGGTAAGCAAAAACACACAATCACCCCCTCATCCAATCTAAATACCAACTAACATGAAAC
AGTGACTACAACTACGAAATCCAATCCGACGGCAGCTGCGGCCTCGTCCCAGGTCTCCAACCCCAAGACCACATC
GCACAATGCGCCCAAGATCCCGAAAAGGTTGAATACTGGGAACCCACCGGCTACCGTCGGATTCCGCAGACAACC
TGCGAAGGCGGCCTCCTACTAGACCAGGACGTGTCAAAACCGTGCCCATCCAAAGAAAAAGAGTACCAAAAGAAG
CACGGCATCAGCGGAACAGGTCTATTCTTCGCGATCGTGACACCCATCGTCGCCGCCGTCGCCGTAGGCTGGTAC
GTGTACACGCACTGGGACGGCAAATTCGGCCAGATCCGGCTGGGCGATACCGGCGTCGCATCGCATAGCTGGTTA
TCCAGGGACTCGGTGCTGGTCGTGGTACCTGTGGCGATTATCGCGGGTATTGTTGCAGTTGCGCAGTCTTTGCCG
TTACTTGTTAAGAGTCTGGCGCGGAGCGCGTCTGGTCTGTTTGGCAGGCGTGGGGCGCAGAGACCTTATGCTACG
CGTGGGTCGTTTGCGGCGAGGAGAGGGGATTATTCTTCTGTTGTTGATGATGAGGATGAGCTGCTTGGGGCTGAT
GATTTTGACGATGAGGAGGAGCAGGCTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail