Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g8889.t1
Gene name
Locationscaffold_38:118767..121337
Strand+
Gene length (bp)2570
Transcript length (bp)2511
Coding sequence length (bp)2511
Protein length (aa) 837

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01487 DHquinase_I Type I 3-dehydroquinase 2.6E-37 266 482
PF01202 SKI Shikimate kinase 3.3E-18 53 180
PF08501 Shikimate_dh_N Shikimate dehydrogenase substrate binding domain 1.6E-13 496 576
PF01488 Shikimate_DH Shikimate / quinate 5-dehydrogenase 2.6E-08 634 680

GO

GO Term Description Terminal node
GO:0003855 3-dehydroquinate dehydratase activity Yes
GO:0055114 oxidation-reduction process Yes
GO:0004764 shikimate 3-dehydrogenase (NADP+) activity Yes
GO:0008150 biological_process No
GO:0016835 carbon-oxygen lyase activity No
GO:0016829 lyase activity No
GO:0008152 metabolic process No
GO:0016491 oxidoreductase activity No
GO:0003824 catalytic activity No
GO:0016614 oxidoreductase activity, acting on CH-OH group of donors No
GO:0016836 hydro-lyase activity No
GO:0003674 molecular_function No
GO:0016616 oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 41 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g8889.t1
MLDSKPSISPTVDAKSDIPACATKESSSPTMLRPESAPRTFAPNASLILIGIRGCGKRSLGFVAATALKRRFITE
DHYFREVTGVTRQEYLKRYGSQEFQRRDIEVLKMMLDNHRTGCVVECGLASLTRPVQDHLRRYARSNPVVHLLRD
IDRIQQLLGLEDQAVRLFREGDPMHRMCSNFEFYNLEDRTPASEDGSPDRRSADYSFKLQEVKEDFTRFVQFITG
LDVNYSSYDSPFVLLETPPELRSFTHAIFVRSSDLIADNVNLTELESGGDAIELCVDRWAPDMAATISKQVSVLR
RNARTPVILSVDTSSIGVRSPEPATSSSRSYFDILAHGLRLGVEYLVVDLTQDQSRLAGTIIGRGNTKIIGQQVF
EPSSPTTWDSADCVAIYNEAEKLGCQLVRLLRVATNREDNAAVTEFTNKIRSLPGDHPPLIAYNVGALGRTSQVF
NSILTAVTHPAITQSADYKHDPQITSRDAVRALFQSYVLDPLKFYIYGENVAYSLSPAMHNAAHQHCGMGHTYSI
PESPSLAVLDRLGRDPHFGGSSVVQPWRVQVYQKLASKSRHAEAIGAINTIMPLRGHADGTMFPLQEQASRRNQA
GRVLGWYGENTDWVGIMTCIRRHLSPRNAISAKTTGLVIGAGGMARAAIYAMLRLGCRKIFIYNRTQSRAEEVAR
HFNSWASSQVDSAEVVCVLKSLQEDWPAGTAQPSLVASCVPADPDRDEPPANFEMPMQWLGSPTGGVILELAYKP
LDTPLLRQMRRVRSETGRPWVLSDGLENVTEQGIAQFELMTGRKAPRRLMTYEVLHNYVGDSGRFDEKTIQARLD
GVGSPVTQKQE*
Coding >Pro_DTO377G3_2|g8889.t1
ATGCTCGATTCTAAACCCTCAATTTCCCCCACGGTCGACGCCAAGTCCGACATCCCCGCATGTGCCACCAAGGAA
TCCTCCTCTCCAACCATGCTCCGCCCCGAGTCCGCCCCTCGAACATTTGCTCCCAATGCATCCCTCATCCTGATC
GGCATCCGCGGATGCGGCAAGCGCTCGCTAGGCTTTGTCGCCGCGACCGCGCTGAAGCGACGCTTCATTACCGAA
GACCACTACTTCCGAGAGGTTACAGGCGTCACGCGACAGGAATACCTCAAGCGGTACGGCAGCCAGGAGTTCCAG
CGACGTGACATCGAAGTCCTGAAAATGATGCTGGATAACCACCGCACGGGCTGCGTCGTGGAGTGTGGGCTTGCC
AGTCTGACGCGACCTGTGCAGGATCATCTGCGTCGCTATGCCCGGTCCAACCCAGTGGTGCATCTGCTGCGCGAT
ATCGATCGCATTCAGCAGTTGCTCGGTTTAGAGGACCAGGCGGTACGGTTGTTTCGGGAGGGGGACCCGATGCAT
CGGATGTGTTCGAATTTCGAATTCTATAATCTTGAAGATCGAACGCCTGCGTCGGAGGATGGGAGCCCCGATCGC
CGGTCTGCGGATTATTCATTCAAACTGCAAGAAGTAAAAGAGGACTTTACGCGGTTTGTGCAGTTTATTACTGGA
CTCGATGTGAACTATTCAAGCTACGATTCGCCGTTCGTTCTGCTGGAGACGCCCCCAGAACTGCGCTCTTTTACC
CATGCTATCTTCGTGCGATCTTCCGATCTGATCGCCGACAATGTCAACCTGACTGAACTTGAATCTGGTGGAGAT
GCCATTGAGCTTTGTGTCGATCGATGGGCCCCAGACATGGCAGCCACTATCAGCAAACAGGTCTCTGTCCTGCGT
CGAAATGCGCGGACGCCTGTGATTCTCTCCGTTGACACCTCATCCATCGGCGTCCGCTCCCCGGAGCCAGCCACC
TCTTCTTCTCGATCTTACTTTGATATTCTCGCGCACGGTCTGCGCCTGGGTGTGGAATATCTTGTTGTAGACCTA
ACTCAAGACCAATCCCGGCTGGCTGGGACTATCATAGGTCGGGGGAATACCAAGATCATCGGCCAGCAGGTCTTT
GAACCATCTTCCCCCACTACATGGGACAGTGCGGACTGCGTCGCCATCTACAACGAAGCTGAAAAGCTCGGCTGC
CAGCTCGTCCGCCTCCTCCGAGTTGCAACAAATCGCGAGGACAATGCCGCTGTGACTGAGTTTACTAATAAAATC
CGATCGCTCCCGGGAGATCACCCACCGCTCATTGCCTATAACGTTGGTGCCCTAGGGCGCACCTCACAAGTGTTC
AACTCAATCCTCACTGCAGTAACACACCCAGCGATCACCCAGTCTGCAGATTATAAGCACGACCCGCAAATAACC
TCTCGCGACGCAGTCCGCGCTCTATTCCAAAGTTACGTGCTCGACCCGCTCAAGTTCTACATCTACGGGGAGAAT
GTCGCCTACAGTTTATCCCCGGCAATGCACAATGCGGCACACCAACACTGCGGCATGGGCCACACCTACAGCATC
CCAGAGTCACCCTCTCTCGCGGTATTAGACCGACTGGGCCGTGATCCACACTTTGGGGGATCCAGCGTCGTGCAG
CCATGGCGCGTACAGGTATATCAAAAGCTCGCCTCGAAAAGCCGACACGCCGAAGCCATCGGGGCAATCAACACG
ATCATGCCGCTCCGCGGACACGCAGACGGAACAATGTTCCCACTTCAGGAACAAGCCAGCCGACGCAACCAAGCC
GGGCGCGTGCTGGGATGGTACGGTGAAAACACTGACTGGGTCGGGATAATGACGTGCATACGGCGACATCTCTCC
CCGCGCAACGCGATTAGCGCAAAAACAACAGGCCTAGTGATTGGCGCGGGTGGCATGGCGCGGGCCGCCATCTAT
GCCATGCTCCGACTTGGGTGTCGGAAGATCTTCATATACAACCGCACGCAATCGCGTGCCGAGGAAGTCGCGCGT
CATTTCAACTCCTGGGCGTCGTCGCAAGTCGACTCGGCTGAGGTAGTTTGTGTCTTGAAGTCGCTTCAGGAAGAC
TGGCCCGCGGGCACTGCTCAGCCTAGTCTCGTTGCGTCTTGTGTGCCGGCTGATCCAGACCGAGATGAACCACCG
GCAAACTTTGAGATGCCAATGCAGTGGCTTGGGAGTCCTACGGGGGGTGTGATTCTCGAGTTGGCATATAAACCC
CTCGATACGCCACTTCTACGACAAATGCGCCGAGTCCGGAGCGAGACCGGACGGCCTTGGGTCTTGTCTGACGGA
TTAGAGAATGTTACCGAACAGGGAATTGCTCAGTTTGAGTTGATGACCGGTCGCAAGGCACCTCGGCGGCTTATG
ACCTATGAGGTTCTACATAATTATGTGGGTGATAGTGGGCGTTTTGACGAGAAGACTATTCAGGCTCGTCTAGAT
GGTGTTGGGTCTCCGGTTACTCAGAAACAGGAATAG
Transcript >Pro_DTO377G3_2|g8889.t1
ATGCTCGATTCTAAACCCTCAATTTCCCCCACGGTCGACGCCAAGTCCGACATCCCCGCATGTGCCACCAAGGAA
TCCTCCTCTCCAACCATGCTCCGCCCCGAGTCCGCCCCTCGAACATTTGCTCCCAATGCATCCCTCATCCTGATC
GGCATCCGCGGATGCGGCAAGCGCTCGCTAGGCTTTGTCGCCGCGACCGCGCTGAAGCGACGCTTCATTACCGAA
GACCACTACTTCCGAGAGGTTACAGGCGTCACGCGACAGGAATACCTCAAGCGGTACGGCAGCCAGGAGTTCCAG
CGACGTGACATCGAAGTCCTGAAAATGATGCTGGATAACCACCGCACGGGCTGCGTCGTGGAGTGTGGGCTTGCC
AGTCTGACGCGACCTGTGCAGGATCATCTGCGTCGCTATGCCCGGTCCAACCCAGTGGTGCATCTGCTGCGCGAT
ATCGATCGCATTCAGCAGTTGCTCGGTTTAGAGGACCAGGCGGTACGGTTGTTTCGGGAGGGGGACCCGATGCAT
CGGATGTGTTCGAATTTCGAATTCTATAATCTTGAAGATCGAACGCCTGCGTCGGAGGATGGGAGCCCCGATCGC
CGGTCTGCGGATTATTCATTCAAACTGCAAGAAGTAAAAGAGGACTTTACGCGGTTTGTGCAGTTTATTACTGGA
CTCGATGTGAACTATTCAAGCTACGATTCGCCGTTCGTTCTGCTGGAGACGCCCCCAGAACTGCGCTCTTTTACC
CATGCTATCTTCGTGCGATCTTCCGATCTGATCGCCGACAATGTCAACCTGACTGAACTTGAATCTGGTGGAGAT
GCCATTGAGCTTTGTGTCGATCGATGGGCCCCAGACATGGCAGCCACTATCAGCAAACAGGTCTCTGTCCTGCGT
CGAAATGCGCGGACGCCTGTGATTCTCTCCGTTGACACCTCATCCATCGGCGTCCGCTCCCCGGAGCCAGCCACC
TCTTCTTCTCGATCTTACTTTGATATTCTCGCGCACGGTCTGCGCCTGGGTGTGGAATATCTTGTTGTAGACCTA
ACTCAAGACCAATCCCGGCTGGCTGGGACTATCATAGGTCGGGGGAATACCAAGATCATCGGCCAGCAGGTCTTT
GAACCATCTTCCCCCACTACATGGGACAGTGCGGACTGCGTCGCCATCTACAACGAAGCTGAAAAGCTCGGCTGC
CAGCTCGTCCGCCTCCTCCGAGTTGCAACAAATCGCGAGGACAATGCCGCTGTGACTGAGTTTACTAATAAAATC
CGATCGCTCCCGGGAGATCACCCACCGCTCATTGCCTATAACGTTGGTGCCCTAGGGCGCACCTCACAAGTGTTC
AACTCAATCCTCACTGCAGTAACACACCCAGCGATCACCCAGTCTGCAGATTATAAGCACGACCCGCAAATAACC
TCTCGCGACGCAGTCCGCGCTCTATTCCAAAGTTACGTGCTCGACCCGCTCAAGTTCTACATCTACGGGGAGAAT
GTCGCCTACAGTTTATCCCCGGCAATGCACAATGCGGCACACCAACACTGCGGCATGGGCCACACCTACAGCATC
CCAGAGTCACCCTCTCTCGCGGTATTAGACCGACTGGGCCGTGATCCACACTTTGGGGGATCCAGCGTCGTGCAG
CCATGGCGCGTACAGGTATATCAAAAGCTCGCCTCGAAAAGCCGACACGCCGAAGCCATCGGGGCAATCAACACG
ATCATGCCGCTCCGCGGACACGCAGACGGAACAATGTTCCCACTTCAGGAACAAGCCAGCCGACGCAACCAAGCC
GGGCGCGTGCTGGGATGGTACGGTGAAAACACTGACTGGGTCGGGATAATGACGTGCATACGGCGACATCTCTCC
CCGCGCAACGCGATTAGCGCAAAAACAACAGGCCTAGTGATTGGCGCGGGTGGCATGGCGCGGGCCGCCATCTAT
GCCATGCTCCGACTTGGGTGTCGGAAGATCTTCATATACAACCGCACGCAATCGCGTGCCGAGGAAGTCGCGCGT
CATTTCAACTCCTGGGCGTCGTCGCAAGTCGACTCGGCTGAGGTAGTTTGTGTCTTGAAGTCGCTTCAGGAAGAC
TGGCCCGCGGGCACTGCTCAGCCTAGTCTCGTTGCGTCTTGTGTGCCGGCTGATCCAGACCGAGATGAACCACCG
GCAAACTTTGAGATGCCAATGCAGTGGCTTGGGAGTCCTACGGGGGGTGTGATTCTCGAGTTGGCATATAAACCC
CTCGATACGCCACTTCTACGACAAATGCGCCGAGTCCGGAGCGAGACCGGACGGCCTTGGGTCTTGTCTGACGGA
TTAGAGAATGTTACCGAACAGGGAATTGCTCAGTTTGAGTTGATGACCGGTCGCAAGGCACCTCGGCGGCTTATG
ACCTATGAGGTTCTACATAATTATGTGGGTGATAGTGGGCGTTTTGACGAGAAGACTATTCAGGCTCGTCTAGAT
GGTGTTGGGTCTCCGGTTACTCAGAAACAGGAATAG
Gene >Pro_DTO377G3_2|g8889.t1
ATGCTCGATTCTAAACCCTCAATTTCCCCCACGGTCGACGCCAAGTCCGACATCCCCGCATGTGCCACCAAGGAA
TCCTCCTCTCCAACCATGCTCCGCCCCGAGTCCGCCCCTCGAACATTTGCTCCCAATGCATCCCTCATCCTGATC
GGCATCCGCGGATGCGGCAAGCGCTCGCTAGGCTTTGTCGCCGCGACCGCGCTGAAGCGACGCTTCATTACCGAA
GACCACTACTTCCGAGAGGTTACAGGCGTCACGCGACAGGAATACCTCAAGCGGTACGGCAGCCAGGAGTTCCAG
CGACGTGACATCGAAGTCCTGAAAATGATGCTGGATAACCACCGCACGGGCTGCGTCGTGGAGTGTGGGCTTGCC
AGTCTGACGCGACCTGTGCAGGATCATCTGCGTCGCTATGCCCGGTCCAACCCAGTGGTGCATCTGCTGCGCGAT
ATCGATCGCATTCAGCAGTTGCTCGGTTTAGAGGACCAGGCGGTACGGTTGTTTCGGGAGGGGGACCCGATGCAT
CGGATGTGTTCGAATTTCGAATTCTATAATCTTGAAGATCGAACGCCTGCGTCGGAGGATGGGAGCCCCGATCGC
CGGTCTGCGGATTATTCATTCAAACTGCAAGAAGTAAAAGAGGACTTTACGCGGTTTGTGCAGTTTATTACTGGA
CTCGATGTGAACTATTCAAGCTACGATTCGCCGTTCGTTCTGCTGGAGACGCCCCCAGAACTGCGCTCTTTTACC
CATGCTATCTTCGTGCGATCTTCCGATCTGATCGCCGACAATGTCAACCTGACTGAACTTGAATCTGGTGGAGAT
GCCATTGAGCTTTGTGTCGATCGATGGGCCCCAGACATGGCAGCCACTATCAGCAAACAGGTCTCTGTCCTGCGT
CGAAATGCGCGGACGCCTGTGATTCTCTCCGTTGACACCTCATCCATCGGCGTCCGCTCCCCGGAGCCAGCCACC
TCTTCTTCTCGATCTTACTTTGATATTCTCGCGCACGGTCTGCGCCTGGGTGTGGAATATCTTGTTGTAGACCTA
ACTCAAGACCAATCCCGGCTGGCTGGGACTATCATAGGTCGGGGGAATACCAAGATCATCGGCCAGCAGGTCTTT
GAACCATCTTCCCCCACTACATGGGACAGTGCGGACTGCGTCGCCATCTACAACGAAGCTGAAAAGCTCGGCTGC
CAGCTCGTCCGCCTCCTCCGAGTTGCAACAAATCGCGAGGACAATGCCGCTGTGACTGAGTTTACTAATAAAATC
CGATCGCTCCCGGGAGATCACCCACCGCTCATTGCCTATAACGTTGGTGCCCTAGGGCGCACCTCACAAGTGTTC
AACTCAATCCTCACTGCAGTAACACACCCAGCGATCACCCAGTCTGCAGATTATAAGCACGACCCGCAAATAACC
TCTCGCGACGCAGTCCGCGCTCTATTCCAAAGTTACGTGCTCGACCCGCTCAAGTTCTACATCTACGGGGAGAAT
GTCGCCTACAGTTTATCCCCGGCAATGCACAATGCGGCACACCAACACTGCGGCATGGGCCACACCTACAGCATC
CCAGAGTCACCCTCTCTCGCGGTATTAGACCGACTGGGCCGTGATCCACACTTTGGGGGATCCAGCGTCGTGCAG
CCATGGCGCGTACAGGTATATCAAAAGCTCGCCTCGAAAAGCCGACACGCCGAAGCCATCGGGGCAATCAACACG
ATCATGCCGCTCCGCGGACACGCAGACGGAACAATGTTCCCACTTCAGGAACAAGCCAGCCGACGCAACCAAGCC
GGGCGCGTGCTGGGATGGTACGGTGAAAACACTGACTGGGTCGGGATAATGACGTGCATACGGCGACATCTCTCC
CCGCGCAACGCGATTAGCGCAAAAACAACAGGCCTAGTGATTGGCGCGGGTGGCATGGCGCGGGCCGCCATCTAT
GCCATGCTCCGACTTGGGTGTCGGAAGATCTTCATATACAACCGCACGCAATCGCGTGCCGAGGAAGTCGCGCGT
CATTTCAACTCCTGGGCGTCGTCGCAAGTCGACTCGGCTGAGGTAGTTTGTGTCTTGAAGTCGCTTCAGGAAGAC
TGGCCCGCGGGCACTGCTCAGCCTAGTCTCGTTGCGTCTTGTGTGCCGGCTGATCCAGACCGAGATGAACCACCG
GCAAACTTTGAGATGCCAATGCAGTGGCTTGGGAGTCCTACGGGGGGTGTGATTCTCGAGGTGAGCTTTTTTCCC
CCGGGATATTTTGACTTCTTGTCACACGTACTAATTGCATATAGTTGGCATATAAACCCCTCGATACGCCACTTC
TACGACAAATGCGCCGAGTCCGGAGCGAGACCGGACGGCCTTGGGTCTTGTCTGACGGATTAGAGAATGTTACCG
AACAGGGAATTGCTCAGTTTGAGTTGATGACCGGTCGCAAGGCACCTCGGCGGCTTATGACCTATGAGGTTCTAC
ATAATTATGTGGGTGATAGTGGGCGTTTTGACGAGAAGACTATTCAGGCTCGTCTAGATGGTGTTGGGTCTCCGG
TTACTCAGAAACAGGAATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail