Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g8882.t1
Gene name
Locationscaffold_38:95669..99712
Strand-
Gene length (bp)4043
Transcript length (bp)2358
Coding sequence length (bp)2358
Protein length (aa) 786

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00891 Methyltransf_2 O-methyltransferase domain 1.8E-08 228 332

GO

GO Term Description Terminal node
GO:0008171 O-methyltransferase activity Yes
GO:0016741 transferase activity, transferring one-carbon groups No
GO:0008168 methyltransferase activity No
GO:0016740 transferase activity No
GO:0003674 molecular_function No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 17 0.45

Transmembrane Domains

Domain # Start End Length
1 356 375 19
2 396 418 22
3 452 474 22
4 481 503 22
5 548 570 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g8882.t1
MSFLTRLASLLGLSSSAPVAPPGAALAATVTVPASLGFVPVAIHFDLFNILVGHGGPATADEVSATCNARIKARG
GDEPELSTRLASDTLYIMAGLGLVERVAEDCFTANAITNHMVAMPSAQHGALHFTTEGLMAGAFLMKKLRDTQFA
YPFAEADGPLQYAYQLMGQSELAKQHTYSIMEAQGRMDSFNHFMVGKFLKFGTFPERVKSMGYDLDGALAGDTTT
GTLAGSATMVDIGGGRGELLLEVQAVYPHLGVDDLIVQEFNADIDDVPGVRLMEWNYKNEAEQPVRGACVYALQH
ILHNLPDLDAVALLQKISRAMTPGSRVLIIEYAKNLTYTALHASMIAIEGDVDIGTGTFQACWVLTSIVGVALLF
RYAIKIWVRWALPQVTAPGRIWGTEDLFFLVAWGFDITHMVLIQMSANSGLGRHFFYLTGEERLYAMKWDFLSQP
MAVTSAMVSRAGMMWFLLTCFAASDKKIRQSIIVCAVVQVVVNMVTIVQIIVQCGPNPYQTTDRVQYFHYMWTPL
PEDGSVKCQSPVVQTTVGFVQGGFNTVIDFFLAVLAAVELWQFFLRTLHRNPNTSFWSQFRKINGTVRSRRIWQT
ITLSGPLLLSGCASIVKTYKLKSLGDRQDFTYNIVTFVLWVKIENYSILLASCAPVARLFLRSFIDHRREGRYHG
YWSRSRSTAHNEPDTEMKRRVNVQDQWLDSATVTNMTNTYIKDEEDHWNGHGHERSVSQISKAEMPDHHDDGCVT
IKTDIVVQVDDGRSISSGGTRLLPNGGESHFGGFH*
Coding >Pro_DTO377G3_2|g8882.t1
ATGTCCTTCCTCACCCGCTTGGCCAGCCTACTGGGCTTGTCATCTTCGGCCCCCGTTGCACCCCCAGGCGCCGCA
CTCGCAGCAACCGTCACAGTACCTGCATCGTTGGGATTTGTCCCGGTCGCGATTCACTTTGATCTCTTCAATATC
CTCGTGGGTCACGGGGGACCTGCGACGGCCGACGAAGTCTCGGCTACCTGCAATGCACGCATCAAAGCCCGAGGG
GGAGATGAACCCGAGCTGAGTACCAGATTAGCCTCGGACACACTCTACATTATGGCCGGACTCGGCCTAGTTGAA
CGCGTGGCCGAGGACTGCTTCACAGCAAATGCCATCACAAACCACATGGTCGCCATGCCTTCCGCCCAGCATGGC
GCACTGCACTTCACCACCGAGGGTCTAATGGCCGGCGCATTTTTGATGAAAAAGCTCCGAGACACCCAATTCGCA
TACCCTTTTGCTGAAGCAGACGGCCCCTTGCAATACGCCTATCAGCTAATGGGTCAGTCTGAGCTGGCAAAGCAG
CACACGTACTCAATTATGGAGGCTCAGGGTCGCATGGATAGTTTCAACCATTTCATGGTCGGCAAGTTCCTGAAG
TTCGGAACATTCCCCGAGCGCGTCAAATCGATGGGCTATGATCTAGATGGTGCTTTGGCAGGTGACACTACCACT
GGCACCCTCGCTGGCTCCGCTACTATGGTCGACATCGGCGGCGGTCGTGGCGAACTCCTCCTTGAGGTTCAGGCC
GTATATCCGCATCTCGGTGTGGATGATCTAATCGTGCAGGAGTTCAATGCGGATATCGATGATGTGCCTGGCGTG
CGTCTTATGGAGTGGAATTACAAAAATGAGGCTGAGCAGCCCGTTCGGGGTGCGTGTGTTTACGCGCTGCAACAT
ATCTTGCATAATTTGCCTGATTTGGATGCTGTAGCGTTGCTGCAGAAGATTTCGCGTGCTATGACACCTGGTTCG
CGAGTTTTGATTATTGAGTACGCCAAGAATTTGACTTATACTGCGCTTCATGCGAGTATGATTGCGATTGAGGGC
GATGTTGATATCGGAACCGGCACATTTCAGGCTTGCTGGGTCCTCACATCCATTGTCGGCGTAGCATTGTTGTTC
CGCTATGCTATCAAGATCTGGGTGCGTTGGGCTTTACCGCAGGTCACTGCACCTGGTCGAATTTGGGGTACAGAG
GACTTATTCTTCCTCGTGGCTTGGGGTTTTGATATCACTCATATGGTACTTATTCAAATGAGTGCCAACTCGGGC
CTTGGGAGACATTTCTTCTACTTAACTGGGGAAGAGCGTCTTTATGCTATGAAATGGGACTTTCTTTCACAGCCG
ATGGCTGTCACTTCGGCAATGGTGTCACGCGCAGGCATGATGTGGTTTCTTTTGACTTGCTTTGCAGCCAGCGAC
AAGAAGATTCGACAATCTATTATCGTCTGCGCCGTTGTTCAGGTTGTCGTCAATATGGTTACAATCGTCCAGATT
ATTGTCCAGTGCGGACCGAACCCGTATCAAACGACTGATCGAGTACAATACTTTCACTATATGTGGACACCACTC
CCTGAAGATGGTTCCGTCAAGTGCCAATCACCGGTTGTCCAAACGACTGTAGGCTTTGTACAAGGAGGATTCAAC
ACCGTGATCGATTTCTTCCTTGCCGTGCTTGCTGCAGTCGAACTCTGGCAATTCTTCCTGCGAACCCTCCACCGT
AATCCAAACACCTCATTCTGGTCTCAATTCCGCAAAATTAATGGCACCGTTCGATCCCGCCGGATCTGGCAGACC
ATCACGCTCAGTGGACCACTCTTGCTCTCTGGCTGTGCTTCTATTGTAAAGACCTATAAACTCAAATCGCTTGGT
GACAGACAAGACTTCACCTATAATATCGTGACGTTCGTTCTCTGGGTAAAGATTGAGAACTACAGCATCCTCCTC
GCCTCCTGTGCCCCAGTAGCCCGCCTCTTCCTCCGGTCCTTCATTGACCACAGACGCGAGGGCCGGTATCACGGC
TACTGGTCTCGCTCTCGGTCAACCGCACATAATGAGCCAGACACAGAGATGAAGCGCCGCGTTAATGTTCAGGAC
CAGTGGCTGGATTCGGCTACAGTGACTAATATGACCAATACTTATATTAAGGATGAGGAGGATCACTGGAATGGA
CATGGGCATGAGCGCTCTGTCAGTCAGATTTCGAAGGCGGAGATGCCGGACCATCATGATGATGGATGTGTTACT
ATTAAGACAGATATTGTTGTTCAAGTTGATGATGGGAGGTCGATCTCTTCGGGTGGGACGAGGTTGTTGCCTAAT
GGGGGTGAATCTCATTTTGGGGGATTTCATTGA
Transcript >Pro_DTO377G3_2|g8882.t1
ATGTCCTTCCTCACCCGCTTGGCCAGCCTACTGGGCTTGTCATCTTCGGCCCCCGTTGCACCCCCAGGCGCCGCA
CTCGCAGCAACCGTCACAGTACCTGCATCGTTGGGATTTGTCCCGGTCGCGATTCACTTTGATCTCTTCAATATC
CTCGTGGGTCACGGGGGACCTGCGACGGCCGACGAAGTCTCGGCTACCTGCAATGCACGCATCAAAGCCCGAGGG
GGAGATGAACCCGAGCTGAGTACCAGATTAGCCTCGGACACACTCTACATTATGGCCGGACTCGGCCTAGTTGAA
CGCGTGGCCGAGGACTGCTTCACAGCAAATGCCATCACAAACCACATGGTCGCCATGCCTTCCGCCCAGCATGGC
GCACTGCACTTCACCACCGAGGGTCTAATGGCCGGCGCATTTTTGATGAAAAAGCTCCGAGACACCCAATTCGCA
TACCCTTTTGCTGAAGCAGACGGCCCCTTGCAATACGCCTATCAGCTAATGGGTCAGTCTGAGCTGGCAAAGCAG
CACACGTACTCAATTATGGAGGCTCAGGGTCGCATGGATAGTTTCAACCATTTCATGGTCGGCAAGTTCCTGAAG
TTCGGAACATTCCCCGAGCGCGTCAAATCGATGGGCTATGATCTAGATGGTGCTTTGGCAGGTGACACTACCACT
GGCACCCTCGCTGGCTCCGCTACTATGGTCGACATCGGCGGCGGTCGTGGCGAACTCCTCCTTGAGGTTCAGGCC
GTATATCCGCATCTCGGTGTGGATGATCTAATCGTGCAGGAGTTCAATGCGGATATCGATGATGTGCCTGGCGTG
CGTCTTATGGAGTGGAATTACAAAAATGAGGCTGAGCAGCCCGTTCGGGGTGCGTGTGTTTACGCGCTGCAACAT
ATCTTGCATAATTTGCCTGATTTGGATGCTGTAGCGTTGCTGCAGAAGATTTCGCGTGCTATGACACCTGGTTCG
CGAGTTTTGATTATTGAGTACGCCAAGAATTTGACTTATACTGCGCTTCATGCGAGTATGATTGCGATTGAGGGC
GATGTTGATATCGGAACCGGCACATTTCAGGCTTGCTGGGTCCTCACATCCATTGTCGGCGTAGCATTGTTGTTC
CGCTATGCTATCAAGATCTGGGTGCGTTGGGCTTTACCGCAGGTCACTGCACCTGGTCGAATTTGGGGTACAGAG
GACTTATTCTTCCTCGTGGCTTGGGGTTTTGATATCACTCATATGGTACTTATTCAAATGAGTGCCAACTCGGGC
CTTGGGAGACATTTCTTCTACTTAACTGGGGAAGAGCGTCTTTATGCTATGAAATGGGACTTTCTTTCACAGCCG
ATGGCTGTCACTTCGGCAATGGTGTCACGCGCAGGCATGATGTGGTTTCTTTTGACTTGCTTTGCAGCCAGCGAC
AAGAAGATTCGACAATCTATTATCGTCTGCGCCGTTGTTCAGGTTGTCGTCAATATGGTTACAATCGTCCAGATT
ATTGTCCAGTGCGGACCGAACCCGTATCAAACGACTGATCGAGTACAATACTTTCACTATATGTGGACACCACTC
CCTGAAGATGGTTCCGTCAAGTGCCAATCACCGGTTGTCCAAACGACTGTAGGCTTTGTACAAGGAGGATTCAAC
ACCGTGATCGATTTCTTCCTTGCCGTGCTTGCTGCAGTCGAACTCTGGCAATTCTTCCTGCGAACCCTCCACCGT
AATCCAAACACCTCATTCTGGTCTCAATTCCGCAAAATTAATGGCACCGTTCGATCCCGCCGGATCTGGCAGACC
ATCACGCTCAGTGGACCACTCTTGCTCTCTGGCTGTGCTTCTATTGTAAAGACCTATAAACTCAAATCGCTTGGT
GACAGACAAGACTTCACCTATAATATCGTGACGTTCGTTCTCTGGGTAAAGATTGAGAACTACAGCATCCTCCTC
GCCTCCTGTGCCCCAGTAGCCCGCCTCTTCCTCCGGTCCTTCATTGACCACAGACGCGAGGGCCGGTATCACGGC
TACTGGTCTCGCTCTCGGTCAACCGCACATAATGAGCCAGACACAGAGATGAAGCGCCGCGTTAATGTTCAGGAC
CAGTGGCTGGATTCGGCTACAGTGACTAATATGACCAATACTTATATTAAGGATGAGGAGGATCACTGGAATGGA
CATGGGCATGAGCGCTCTGTCAGTCAGATTTCGAAGGCGGAGATGCCGGACCATCATGATGATGGATGTGTTACT
ATTAAGACAGATATTGTTGTTCAAGTTGATGATGGGAGGTCGATCTCTTCGGGTGGGACGAGGTTGTTGCCTAAT
GGGGGTGAATCTCATTTTGGGGGATTTCATTGA
Gene >Pro_DTO377G3_2|g8882.t1
ATGTCCTTCCTCACCCGCTTGGCCAGCCTACTGGGCTTGTCATCTTCGGCCCCCGTTGCACCCCCAGGCGCCGCA
CTCGCAGCAACCGTCACAGTAGTGAGTCTGATGAATCTGTCAGATAATTCTTCTATCTAATTCAGTTACAGCCTG
CATCGTTGGGATTTGTCCCGGTCGCGATTCACTTTGATCTCTTCAATATCCTCGTGGGTCACGGGGGACCTGCGA
CGGCCGACGAAGTCTCGGCTACCTGCAATGCACGCATCAAAGCCCGAGGGGGAGATGAACCCGAGCTGAGTACGT
GTTTCAGTTTGAATGGATAATGGCTTGTTATCATGGCTGTTGTAGATGTTATGCTGACAATGGATATAGGTACCA
GATTAGCCTGTAAGCACACCCTTGTACAGGTATAGGTACAAGCAGTATCCCAATGATATGCTAATGCATTCCTGC
AGCGGACACACTCTACATTATGGCCGGACTCGGCCTAGTTGAACGCGTGGCCGAGGACTGCTTCACAGCAAATGC
CATCACAAACCACATGGTCGCCATGCCTTCCGCCCAGCATGGCGCACTGCACTTGTCAGTTCCCCCATGCATGTC
CTGTTTCTATAATGAGATCAATATAACCAGCCAAGCACGCACTAACCCCATCCAGCACCACCGAGGGTCTAATGG
CCGGCGCATTTTTGATGAAAAAGCTCCGAGACACCCAATTCGCATACCCTTTTGCTGAAGCAGACGGCCCCTTGC
AATACGCCTATCAGCTAATGGGTCAGTCTGAGCTGGCAAAGCAGCACACGTACTCAATTATGGAGGCTCAGGGTC
GCATGGATAGTTTCAACCATTTCATGGTCGGCAAGTTCCTGAAGTTCGGAACATTCCCCGAGCGCGTCAAATCGA
TGGGCTATGATCTAGATGGTGCTTTGGCAGGTGACACTACCACTGGCACCCTCGCTGGCTCCGCTACTATGGTCG
ACATCGGCGGCGGTCGTGGCGAACTCCTCCTTGAGGTTCAGGCCGTATATCCGCATCTCGGTGTGGATGATCTAA
TCGTGCAGGAGTTCAATGCGGATATCGATGATGTGCCTGGCGTGCGTCTTATGGAGTGGAATTACAAAAATGAGG
CTGAGCAGCCCGTTCGGGGTGCGTGTGTTTACGCGCTGCAACATATCTTGCATAATTTGCCTGATTTGGATGCTG
TAGCGTTGCTGCAGAAGATTTCGCGTGCTATGACACCTGGTTCGCGAGTTTTGATTATTGAGTACGCCAAGAATT
TGACTTATACTGCGCTTCATGCGAGTATGATTGCGATGTATGGGGGGCGAGAAAGGAGTTCGGTGGAGTGGAGGC
AGGTGGCGGGATTGTGTGGGCTAGAGGTGACTTTTGAGGTTTATGTTAGGGCTGGAGAGTCATTGGTGGAGATGA
GGAGGGCGGATCGGTAGTTCAGGGTTGAGCGATATAATTCACTGGTTAATTCAATTGGTTAATGGTTGGTTGTTG
ATACTAGTTCATTGTTAATCGTTCTTTGTCAATATGATATATCATTTCTTGATGTATACTCATCACATCCCTTCA
ATCAATAGTTTCGCTTACGTGCATATAGTTTTTATCTCTCGAACTCAGCAGATCTTTGCAGATCCGATCTAGGGG
TGTATCGAATCCATCAATCCCATGTGGATGTGTATTTGATGTATTTCTTTTTCTCATTCTCCGTCACATCCCTTA
CTGCATCTCACATGGCCATTGCATGATTTCCATCCCTCTCCGGAATGTCGCCTGTGCTTGATCCACATGGTCCTG
GCAATGCGAAGTGTCCATTGCCACGATCAAAAGGATGGGATATTTTCTGACACGCAGATTGGCCACACGAGCTTA
ACTCCTGTCATAAGTCAAAACTGGACGTTTCTGACCCCGTACATCAAGGTTCAATACTCTGCCATATCATACAAC
TCGCTTCGCTTGACCCGATTATATTTTCATTGTAAATCAAGGGATTTGCCCTGCATCCCTTGTTTCCTCTCGATC
ATTTTACGTTTATGCGCCCTTCCACCCGTTGGAAACGAGTCTAGACAAGTTTCTGACCTGTAAACCGGTTCGCGC
GAGACTTTTGACAGGATCTCCATTTCTAATAACCTTTAAAGGCAACTTAAAAGCTCTCCTCTACTATCCCTTGGT
GCTGGATTGGATTTGGTTTATATTCTTTCGCATTTGATCCATCTGACCGACCCCGCGCATCGTTCTCGTCTCGTA
TATATGCCAATGAGTATTTGAATTGGATCCCTGCCTATAACCGAGAGGTCTGGTTATTGTGTTTTATCTTCATTA
TGGATATTCCGAAACCTAGTGAGGGCGATGTTGATATCGGTATGTTTACCTGGCAAATGCCAAGCAAATGGACCT
AGAGGATCGTGGATTGACATGTTTAACAGGAACCGGCACATTTCAGGCTTGCTGGGTATGATCTTGATCTTATAA
ATTGCCTCTGGATATATGTATACTAATCCTCGAGCAGGTCCTCACATCCATTGTCGGCGTAGCATTGTTGTTCCG
CTATGCTATCAAGATCTGGGTGCGTTGGGCTTTACCGCAGGTCACTGCACCTGGTCGAATTTGGGGTACAGAGGA
CTTATTCTTCCTCGTGGCTTGGGGTTTTGATATCACTCATATGGTACTTATTCAAATGAGGTGAGGTCGACTAGT
GTCATTCCTCCCAGGTCAGCCATTAACTCTGTCTAGTGCCAACTCGGGCCTTGGGAGACATTTCTTCTACTTAAC
TGGGGAAGAGCGTCTTTATGCTATGAAATGGGACTTTCTTTCACAGCCGATGGCTGTCACTTCGGCAATGGTGTC
ACGCGCAGGCATGATGTGGTTTCTTTTGACTTGCTTTGCAGCCAGCGACAAGAAGATTCGACAATCTATTATCGT
CTGCGCCGTTGTTCAGGTTGTCGTCAATATGGTTACAATCGTCCAGATTATTGTCCAGTGCGGACCGAACCCGTA
TCAAACGGTTAGTATCCTCCTTCTTAGTGCTTGGTCCATTCTAATCTCAGAGCAGACTGATCGAGTACAATACTT
TCACTATATGTGGACACCACTCCCTGAAGATGGTTCCGTCAAGTGCCAATCACCGGTTGTCCAAACGACTGTAGG
CTTTGTACAAGGAGGTATGGAAAATTATATACTTCAGCAGCTCAGCTCAAAGCTAATTGCAATTCGCACAGGATT
CAACACCGTGATCGATTTCTTCCTTGCCGTGCTTGCTGCAGTCGAACTCTGGCAATTCTTCCTGCGAACCCTCCA
CCGTAATCCAAACACCTCATTCTGGTCTCAATTCCGCAAAATTAATGGCACCGTTCGATCCCGCCGGATCTGGCA
GACCATCACGCTCAGTGGACCACTCTTGCTCTCTGGCTGTGCTTCTATTGTAAAGACCTATGTGAGTATAATATC
TTTTCTCGACTTACACAGCAGCGCTAATATCATTCACTAGAAACTCAAATCGCTTGGTGACAGACAAGACTTCAC
CTATAATATCGTGACGTTCGTTCTCTGGGTAAAGTAAGTACAACTACCATCTCCCAATCCCAGTATTATTAACCA
ACACTCCCAGGATTGAGAACTACAGCATCCTCCTCGCCTCCTGTGCCCCAGTAGCCCGCCTCTTCCTCCGGTCCT
TCATTGACCACAGACGCGAGGGCCGGTATCACGGCTACTGGTCTCGCTCTCGGTCAACCGCACATAATGAGCCAG
ACACAGAGATGAAGCGCCGCGTTAATGTTCAGGACCAGTGGCTGGATTCGGCTACAGTGACTAATATGACCAATA
CTTATATTAAGGATGAGGAGGATCACTGGAATGGACATGGGCATGAGCGCTCTGTCAGTCAGATTTCGAAGGCGG
AGATGCCGGACCATCATGATGATGGATGTGTTACTATTAAGACAGATATTGTTGTTCAAGTTGATGATGGGAGGT
CGATCTCTTCGGGTGGGACGAGGTTGTTGCCTAATGGGGGTGAATCTCATTTTGGGGGATTTCATTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail