Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g888.t1
Gene name
Locationscaffold_01:2370384..2371327
Strand+
Gene length (bp)943
Transcript length (bp)873
Coding sequence length (bp)873
Protein length (aa) 291

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01922 SRP19 SRP19 protein 8.6E-34 75 168

GO

GO Term Description Terminal node
GO:0008312 7S RNA binding Yes
GO:0048500 signal recognition particle Yes
GO:0006614 SRP-dependent cotranslational protein targeting to membrane Yes
GO:0071705 nitrogen compound transport No
GO:0045047 protein targeting to ER No
GO:0072594 establishment of protein localization to organelle No
GO:0072599 establishment of protein localization to endoplasmic reticulum No
GO:0006613 cotranslational protein targeting to membrane No
GO:0045184 establishment of protein localization No
GO:0051649 establishment of localization in cell No
GO:0044444 cytoplasmic part No
GO:0046907 intracellular transport No
GO:0008104 protein localization No
GO:0051234 establishment of localization No
GO:0097159 organic cyclic compound binding No
GO:0051641 cellular localization No
GO:0071702 organic substance transport No
GO:0070727 cellular macromolecule localization No
GO:0042886 amide transport No
GO:1901363 heterocyclic compound binding No
GO:0006605 protein targeting No
GO:0051179 localization No
GO:0044464 cell part No
GO:0008150 biological_process No
GO:0033365 protein localization to organelle No
GO:0034613 cellular protein localization No
GO:0005488 binding No
GO:0003723 RNA binding No
GO:0006886 intracellular protein transport No
GO:0044424 intracellular part No
GO:0015031 protein transport No
GO:0003676 nucleic acid binding No
GO:0003674 molecular_function No
GO:0006612 protein targeting to membrane No
GO:0090150 establishment of protein localization to membrane No
GO:0032991 protein-containing complex No
GO:0070972 protein localization to endoplasmic reticulum No
GO:0006810 transport No
GO:0005575 cellular_component No
GO:1990904 ribonucleoprotein complex No
GO:0033036 macromolecule localization No
GO:0015833 peptide transport No
GO:0072657 protein localization to membrane No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 31 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g888.t1
MSRRAQIEEVSDSDPEEIAPSYDSDEDLPRNAIIAPVNIPRAAPQPQQQQMPMPQPMPSMPAPEPQREIPRHFSC
LYPVYFDKTRSRAEGRKVGAELAVENPLARDIVDAVQMLGLNAGLEPEKLHPKDWANPGRVRAQVRTQDGQLANP
KIKNKHHLYILVAQYLKANPTTEKSPYRLRIRGLPMPEKLPAAPAAPRGWKIGTILPIHSPAYSGGGVSDNPLKD
AMAEMQGMEGMPNMSEMMSQMGGMGGLSSMLGGLGGLGGMGGMGGEPSGAGAEKKKKEKRKVIRA*
Coding >Pro_DTO377G3_2|g888.t1
ATGTCGCGTCGCGCCCAAATCGAGGAAGTTTCCGACTCCGACCCAGAAGAGATCGCCCCTTCTTACGACTCTGAC
GAGGACCTTCCCAGAAATGCCATCATCGCACCCGTAAATATCCCGAGGGCTGCACCTCAACCTCAACAACAACAG
ATGCCCATGCCCCAGCCCATGCCATCGATGCCGGCGCCTGAGCCTCAGCGCGAGATTCCCCGACACTTCTCATGC
TTGTACCCCGTGTACTTCGATAAAACCCGATCGCGCGCCGAGGGCCGCAAAGTCGGTGCGGAGCTCGCAGTGGAA
AACCCTCTTGCTCGAGATATCGTCGATGCCGTCCAGATGCTTGGCTTGAATGCCGGCTTGGAGCCAGAGAAGCTG
CATCCTAAGGATTGGGCGAATCCCGGTCGTGTGCGTGCGCAGGTTAGGACCCAAGATGGTCAATTAGCCAACCCG
AAGATCAAGAACAAGCACCACCTCTATATTCTCGTCGCACAGTACTTGAAGGCTAACCCTACCACCGAAAAATCA
CCCTACCGGCTACGAATCCGTGGCCTGCCCATGCCTGAGAAGCTTCCAGCAGCTCCTGCTGCCCCGCGGGGTTGG
AAGATCGGGACGATCCTACCTATCCACTCGCCTGCCTACAGCGGTGGTGGTGTCAGTGACAACCCCCTCAAGGAC
GCAATGGCCGAGATGCAGGGCATGGAGGGAATGCCGAACATGTCTGAAATGATGAGTCAAATGGGCGGAATGGGT
GGACTGAGCAGTATGTTGGGTGGACTAGGCGGGCTAGGCGGAATGGGTGGAATGGGCGGCGAGCCCTCAGGGGCA
GGCGCGGAAAAGAAAAAGAAGGAAAAGAGGAAGGTGATCAGGGCATGA
Transcript >Pro_DTO377G3_2|g888.t1
ATGTCGCGTCGCGCCCAAATCGAGGAAGTTTCCGACTCCGACCCAGAAGAGATCGCCCCTTCTTACGACTCTGAC
GAGGACCTTCCCAGAAATGCCATCATCGCACCCGTAAATATCCCGAGGGCTGCACCTCAACCTCAACAACAACAG
ATGCCCATGCCCCAGCCCATGCCATCGATGCCGGCGCCTGAGCCTCAGCGCGAGATTCCCCGACACTTCTCATGC
TTGTACCCCGTGTACTTCGATAAAACCCGATCGCGCGCCGAGGGCCGCAAAGTCGGTGCGGAGCTCGCAGTGGAA
AACCCTCTTGCTCGAGATATCGTCGATGCCGTCCAGATGCTTGGCTTGAATGCCGGCTTGGAGCCAGAGAAGCTG
CATCCTAAGGATTGGGCGAATCCCGGTCGTGTGCGTGCGCAGGTTAGGACCCAAGATGGTCAATTAGCCAACCCG
AAGATCAAGAACAAGCACCACCTCTATATTCTCGTCGCACAGTACTTGAAGGCTAACCCTACCACCGAAAAATCA
CCCTACCGGCTACGAATCCGTGGCCTGCCCATGCCTGAGAAGCTTCCAGCAGCTCCTGCTGCCCCGCGGGGTTGG
AAGATCGGGACGATCCTACCTATCCACTCGCCTGCCTACAGCGGTGGTGGTGTCAGTGACAACCCCCTCAAGGAC
GCAATGGCCGAGATGCAGGGCATGGAGGGAATGCCGAACATGTCTGAAATGATGAGTCAAATGGGCGGAATGGGT
GGACTGAGCAGTATGTTGGGTGGACTAGGCGGGCTAGGCGGAATGGGTGGAATGGGCGGCGAGCCCTCAGGGGCA
GGCGCGGAAAAGAAAAAGAAGGAAAAGAGGAAGGTGATCAGGGCATGA
Gene >Pro_DTO377G3_2|g888.t1
ATGTCGCGTCGCGCCCAAATCGAGGAAGTTTCCGACTCCGACCCAGAAGAGATCGCCCCTTCTTACGACTCTGAC
GAGGACCTTCCCAGAAATGCCATCATCGCACCCGTAAATATCCCGAGGGCTGCACCTCAACCTCAACAACAACAG
ATGCCCATGCCCCAGCCCATGCCATCGATGCCGGCGCCTGAGCCTCAGCGCGAGATTCCCCGACACTTCTCATGC
TTGTACCCCGTGTACTTCGATAAAACCCGATCGCGCGCCGAGGGCCGCAAAGTCGGTGCGGAGCTCGCAGTGGAA
AACCCTCTTGCTCGAGATATCGTCGATGCCGTCCAGATGCTTGGCTTGAATGCCGGCTTGGAGCCAGAGAAGCTG
CATCCTAAGGATTGGGCGAATCCCGGTCGTGTGCGTGCGCAGGTTAGGACCCAAGATGGTCAATTAGCCAACCCG
AAGATCAAGAACAGTACGTGGCTGATGCCTTTGATGGAGTGAATGCTTCTTTCTGTTGGACATGAACTGACATTG
TTGCTTAGAGCACCACCTCTATATTCTCGTCGCACAGTACTTGAAGGCTAACCCTACCACCGAAAAATCACCCTA
CCGGCTACGAATCCGTGGCCTGCCCATGCCTGAGAAGCTTCCAGCAGCTCCTGCTGCCCCGCGGGGTTGGAAGAT
CGGGACGATCCTACCTATCCACTCGCCTGCCTACAGCGGTGGTGGTGTCAGTGACAACCCCCTCAAGGACGCAAT
GGCCGAGATGCAGGGCATGGAGGGAATGCCGAACATGTCTGAAATGATGAGTCAAATGGGCGGAATGGGTGGACT
GAGCAGTATGTTGGGTGGACTAGGCGGGCTAGGCGGAATGGGTGGAATGGGCGGCGAGCCCTCAGGGGCAGGCGC
GGAAAAGAAAAAGAAGGAAAAGAGGAAGGTGATCAGGGCATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail