Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g8872.t1
Gene name
Locationscaffold_38:70867..73178
Strand+
Gene length (bp)2311
Transcript length (bp)1890
Coding sequence length (bp)1890
Protein length (aa) 630

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00723 Glyco_hydro_15 Glycosyl hydrolases family 15 8.8E-49 44 236
PF00723 Glyco_hydro_15 Glycosyl hydrolases family 15 2.3E-44 250 436
PF00686 CBM_20 Starch binding domain 3.2E-31 510 603

GO

GO Term Description Terminal node
GO:2001070 starch binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No
GO:0030247 polysaccharide binding No
GO:0030246 carbohydrate binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 19 0.45

Transmembrane Domains

Domain # Start End Length
1 5 27 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g8872.t1
MMASHFWAALWVLTLGYAVVVAPQILVPRATGSLDAWLVSETAVAKQGILDNIGSAGAYAATAKPGIVVASPSTS
DPDYYYTWTRDSALVFKTLVDMFKNGDSGLLNIIEEYIDAQAYIQTVSNPSGDLSGGSGLGEPKFNVDETAFTDS
WGRPQRDGPALRATALVSFGQWLIDNGYTTYATNIVWPVVRNDLSYVAQYWNQTGFDLWEEVSGSSFFTVAAQHR
ALVEGSTFASQSFWTGSYILANFGGGRSGKDANTLLATIQTFDPEAGCDDTTFQPCSARALANHKVVTDSFRAIY
PVNSGIAAGKAVSVGRYPEDTYYNGNPWYLCTLAAAEQLYDAIYTWNRIGSLTITSVSLGFFQDLYSSAATGTYS
SSSDTYTSILSAVTAYADGYLSNVEQYAASNGSLFEQFSKSDGSQLSARDLTWSYAALLTANDRRNAIVPAPWGE
TSASSVPGQCQYTSDVGTFSSATNTAWPTTLTSRSGSGTTTTTSAKTTSTTAPCTTPTAVAVTFNVIATTVYGQN
IKLAGSISELGSWSPSSAIALSSSLYTTSNPLWFVTVTLPVGTGFTYKYIQVASDGTITWESDPNLSYTVPTTCG
TTAVTISDTWSTMIMIVYLSWYGDAAVTS*
Coding >Pro_DTO377G3_2|g8872.t1
ATGATGGCTTCTCACTTTTGGGCTGCTCTTTGGGTGCTCACACTTGGCTACGCTGTTGTAGTTGCACCACAGATA
TTGGTCCCTCGTGCGACTGGCAGTCTGGACGCCTGGTTGGTGTCTGAGACAGCAGTGGCAAAACAGGGTATCCTC
GATAACATTGGATCTGCTGGTGCCTATGCTGCGACTGCAAAGCCTGGCATTGTAGTCGCCAGCCCGAGTACCTCT
GACCCTGACTACTACTATACTTGGACTCGTGACTCGGCTCTGGTGTTCAAAACTCTGGTCGATATGTTCAAGAAC
GGTGACAGCGGCTTGTTAAATATTATTGAAGAATACATCGATGCACAGGCCTATATCCAGACGGTATCCAATCCA
TCTGGAGATCTTTCTGGTGGCAGTGGATTGGGGGAGCCTAAGTTCAACGTCGACGAGACAGCCTTCACTGACTCT
TGGGGTCGTCCTCAGCGTGATGGACCGGCCTTGCGAGCCACTGCATTGGTCTCGTTTGGCCAATGGCTCATTGAT
AATGGGTACACCACTTACGCGACCAACATTGTCTGGCCCGTTGTGCGCAACGATCTCTCCTATGTTGCCCAATAC
TGGAATCAGACTGGATTTGATCTCTGGGAAGAAGTTTCTGGCTCATCGTTCTTTACTGTCGCAGCTCAGCATCGC
GCCTTGGTGGAGGGAAGCACATTCGCAAGCCAGTCTTTCTGGACTGGGTCTTATATCCTGGCCAACTTTGGTGGT
GGCCGCTCTGGAAAAGATGCCAACACGCTACTCGCCACCATCCAAACTTTCGACCCAGAGGCCGGATGCGATGAC
ACCACATTCCAGCCTTGCTCAGCTAGAGCACTCGCAAATCACAAAGTTGTGACTGATTCATTCCGGGCGATCTAT
CCTGTCAACTCTGGTATTGCTGCGGGCAAGGCTGTTTCTGTTGGTCGATACCCGGAGGACACATATTACAATGGT
AACCCTTGGTACCTATGCACATTGGCTGCGGCTGAGCAGTTGTACGATGCGATATATACGTGGAATCGTATCGGT
TCTTTGACAATCACCTCTGTCTCTCTCGGCTTCTTCCAGGATCTGTACAGCTCCGCTGCGACCGGTACCTACTCC
TCGTCCAGTGATACATACACCTCGATTCTGAGCGCTGTCACGGCATATGCGGATGGATATCTCAGTAATGTGGAA
CAATACGCTGCATCGAATGGCTCCTTGTTTGAGCAATTCTCCAAGTCAGATGGCTCACAACTCTCGGCTCGTGAC
CTGACTTGGTCCTACGCAGCCCTGCTTACTGCCAATGACCGTCGGAATGCGATAGTTCCTGCACCATGGGGTGAG
ACATCTGCCAGCAGTGTACCTGGCCAATGCCAGTACACTTCGGATGTTGGGACTTTCAGCAGTGCAACAAACACC
GCCTGGCCGACCACGTTGACTAGTAGATCAGGCAGCGGAACTACTACCACTACGTCTGCGAAGACAACCTCGACT
ACAGCACCATGCACTACTCCAACAGCCGTTGCAGTGACATTCAACGTGATTGCCACTACTGTATATGGCCAGAAC
ATCAAGCTTGCTGGATCTATCTCCGAGCTTGGCTCCTGGTCCCCAAGCAGTGCTATTGCGCTGAGCTCTTCTTTG
TACACTACGAGCAACCCTTTGTGGTTTGTGACTGTGACACTTCCGGTGGGCACTGGGTTTACCTACAAGTATATC
CAGGTGGCGAGTGATGGCACTATTACATGGGAGAGTGACCCGAACCTGTCATACACCGTTCCCACCACGTGTGGT
ACCACAGCTGTCACGATTAGTGATACCTGGAGCACCATGATAATGATTGTTTATCTGAGCTGGTACGGTGATGCG
GCCGTCACATCATAA
Transcript >Pro_DTO377G3_2|g8872.t1
ATGATGGCTTCTCACTTTTGGGCTGCTCTTTGGGTGCTCACACTTGGCTACGCTGTTGTAGTTGCACCACAGATA
TTGGTCCCTCGTGCGACTGGCAGTCTGGACGCCTGGTTGGTGTCTGAGACAGCAGTGGCAAAACAGGGTATCCTC
GATAACATTGGATCTGCTGGTGCCTATGCTGCGACTGCAAAGCCTGGCATTGTAGTCGCCAGCCCGAGTACCTCT
GACCCTGACTACTACTATACTTGGACTCGTGACTCGGCTCTGGTGTTCAAAACTCTGGTCGATATGTTCAAGAAC
GGTGACAGCGGCTTGTTAAATATTATTGAAGAATACATCGATGCACAGGCCTATATCCAGACGGTATCCAATCCA
TCTGGAGATCTTTCTGGTGGCAGTGGATTGGGGGAGCCTAAGTTCAACGTCGACGAGACAGCCTTCACTGACTCT
TGGGGTCGTCCTCAGCGTGATGGACCGGCCTTGCGAGCCACTGCATTGGTCTCGTTTGGCCAATGGCTCATTGAT
AATGGGTACACCACTTACGCGACCAACATTGTCTGGCCCGTTGTGCGCAACGATCTCTCCTATGTTGCCCAATAC
TGGAATCAGACTGGATTTGATCTCTGGGAAGAAGTTTCTGGCTCATCGTTCTTTACTGTCGCAGCTCAGCATCGC
GCCTTGGTGGAGGGAAGCACATTCGCAAGCCAGTCTTTCTGGACTGGGTCTTATATCCTGGCCAACTTTGGTGGT
GGCCGCTCTGGAAAAGATGCCAACACGCTACTCGCCACCATCCAAACTTTCGACCCAGAGGCCGGATGCGATGAC
ACCACATTCCAGCCTTGCTCAGCTAGAGCACTCGCAAATCACAAAGTTGTGACTGATTCATTCCGGGCGATCTAT
CCTGTCAACTCTGGTATTGCTGCGGGCAAGGCTGTTTCTGTTGGTCGATACCCGGAGGACACATATTACAATGGT
AACCCTTGGTACCTATGCACATTGGCTGCGGCTGAGCAGTTGTACGATGCGATATATACGTGGAATCGTATCGGT
TCTTTGACAATCACCTCTGTCTCTCTCGGCTTCTTCCAGGATCTGTACAGCTCCGCTGCGACCGGTACCTACTCC
TCGTCCAGTGATACATACACCTCGATTCTGAGCGCTGTCACGGCATATGCGGATGGATATCTCAGTAATGTGGAA
CAATACGCTGCATCGAATGGCTCCTTGTTTGAGCAATTCTCCAAGTCAGATGGCTCACAACTCTCGGCTCGTGAC
CTGACTTGGTCCTACGCAGCCCTGCTTACTGCCAATGACCGTCGGAATGCGATAGTTCCTGCACCATGGGGTGAG
ACATCTGCCAGCAGTGTACCTGGCCAATGCCAGTACACTTCGGATGTTGGGACTTTCAGCAGTGCAACAAACACC
GCCTGGCCGACCACGTTGACTAGTAGATCAGGCAGCGGAACTACTACCACTACGTCTGCGAAGACAACCTCGACT
ACAGCACCATGCACTACTCCAACAGCCGTTGCAGTGACATTCAACGTGATTGCCACTACTGTATATGGCCAGAAC
ATCAAGCTTGCTGGATCTATCTCCGAGCTTGGCTCCTGGTCCCCAAGCAGTGCTATTGCGCTGAGCTCTTCTTTG
TACACTACGAGCAACCCTTTGTGGTTTGTGACTGTGACACTTCCGGTGGGCACTGGGTTTACCTACAAGTATATC
CAGGTGGCGAGTGATGGCACTATTACATGGGAGAGTGACCCGAACCTGTCATACACCGTTCCCACCACGTGTGGT
ACCACAGCTGTCACGATTAGTGATACCTGGAGCACCATGATAATGATTGTTTATCTGAGCTGGTACGGTGATGCG
GCCGTCACATCATAA
Gene >Pro_DTO377G3_2|g8872.t1
ATGATGGCTTCTCACTTTTGGGCTGCTCTTTGGGTGCTCACACTTGGCTACGCTGTTGTAGTTGCACCACAGATA
TTGGTCCCTCGTGCGACTGGCAGTCTGGACGCCTGGTTGGTGTCTGAGACAGCAGTGGCAAAACAGGGTATCCTC
GATAACATTGGATCTGCTGGTGCCTATGCTGCGACTGCAAAGCCTGGCATTGTAGTCGCCAGCCCGAGTACCTCT
GACCCTGACTGTAAGTATTGGATAGCTATTTGTGGCAGCGGAAAACTAACTTAACTGGCCTACAGACTACTATAC
TTGGACTCGTGACTCGGCTCTGGTGTTCAAAACTCTGGTCGATATGTTCAAGAACGGTGACAGCGGCTTGTTAAA
TATTATTGAAGAATACATCGATGCACAGGCCTATATCCAGACGGTATCCAATCCATCTGGAGATCTTTCTGGTGG
CAGTGGATTGGGGGAGCCTAAGTTCAACGTCGACGAGACAGCCTTCACTGACTCTTGGGGTCGTCCTCAGCGTGA
TGGACCGGCCTTGCGAGCCACTGCATTGGTCTCGTTTGGCCAATGGCTCATTGTATAAACCCCGAATCTGTTGGC
TTTTGCATTGCTAACCCATTTAGGATAATGGGTACACCACTTACGCGACCAACATTGTCTGGCCCGTTGTGCGCA
ACGATCTCTCCTATGTTGCCCAATACTGGAATCAGACTGGATTTGGTTATTACACCTCAAATTTTAGTTGCGCAC
ATTTCTAATGCCCTATAGATCTCTGGGAAGAAGTTTCTGGCTCATCGTTCTTTACTGTCGCAGCTCAGCATCGCG
CCTTGGTGGAGGGAAGCACATTCGCAAGCCAGGTTGGTTCCTCGTGTTCGTACTGTGACTCTCAGGCTCCACAGG
TCTTGTGCTTCTTACAGTCTTTCTGGACTGGGTCTTATATCCTGGCCAACTTTGGTGGTGGCCGCTCTGGAAAAG
ATGCCAACACGCTACTCGCCACCATCCAAACTTTCGACCCAGAGGCCGGATGCGATGACACCACATTCCAGCCTT
GCTCAGCTAGAGCACTCGCAAATCACAAAGTTGTGACTGATTCATTCCGGGCGATCTATCCTGTCAACTCTGGTA
TTGCTGCGGGCAAGGCTGTTTCTGTTGGTCGATACCCGGAGGACACATATTACAATGGTAACCCTTGGTACCTAT
GCACATTGGCTGCGGCTGAGCAGTTGTACGATGCGATATATACGTGGAATCGTATCGGTTCTTTGACAATCACCT
CTGTCTCTCTCGGCTTCTTCCAGGATCTGTACAGCTCCGCTGCGACCGGTACCTACTCCTCGTCCAGTGATACAT
ACACCTCGATTCTGAGCGCTGTCACGGCATATGCGGATGGATATCTCAGTAATGTGGTATGTTGCATGCTATCGA
CTATTGACCACCTCAACTGACAGATATCCTAGGAACAATACGCTGCATCGAATGGCTCCTTGTTTGAGCAATTCT
CCAAGTCAGATGGCTCACAACTCTCGGCTCGTGACCTGACTTGGTCCTACGCAGCCCTGCTTACTGCCAATGACC
GTCGGAATGCGATAGTTCCTGCACCATGGGGTGAGACATCTGCCAGCAGTGTACCTGGCCAATGCCAGTACACTT
CGGATGTTGGGACTTTCAGCAGTGCAACAAACACCGCCTGGCCGACCACGTTGACTAGTAGATCAGGCAGCGGAA
CTACTACCACTACGTCTGCGAAGACAACCTCGACTACAGCACCATGCACTACTCCAACAGCCGTTGCAGTGACAT
TCAACGTGATTGCCACTACTGTATATGGCCAGAACATCAAGCTTGCTGGATCTATCTCCGAGCTTGGCTCCTGGT
CCCCAAGCAGTGCTATTGCGCTGAGCTCTTCTTTGTACACTACGAGCAACCCTTTGTGGTTTGTGACTGTGACAC
TTCCGGTGGGCACTGGGTTTACCTACAAGTATATCCAGGTGGCGAGTGATGGCACTATTACATGGGAGAGTGACC
CGAACCTGTCATACACCGTTCCCACCACGTGTGGTACCACAGCTGTCACGATTAGTGATACCTGGAGGTGATAAC
TGAAGTTTTGGATACCTCAATTGAAGATTGTGCATGCTTTATTCTTCTATCGTCGTAGAATAGCACCATGATAAT
GATTGTTTATCTGAGTATTAGCTGTCCGAACACAACCACCGCCTGTCCATTGTGTAGGCGCTGCCGTTTGAACTA
TTACCTGATCGGGCTAACCTTACCGATAGGCTGGTACGGTGATGCGGCCGTCACATCATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail