Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g8858.t1
Gene name
Locationscaffold_38:31632..36025
Strand-
Gene length (bp)4393
Transcript length (bp)2163
Coding sequence length (bp)2163
Protein length (aa) 721

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01544 CorA CorA-like Mg2+ transporter protein 5.1E-09 196 365

GO

GO Term Description Terminal node
GO:0016020 membrane Yes
GO:0055085 transmembrane transport Yes
GO:0030001 metal ion transport Yes
GO:0046873 metal ion transmembrane transporter activity Yes
GO:0022890 inorganic cation transmembrane transporter activity No
GO:0006810 transport No
GO:0008150 biological_process No
GO:0005575 cellular_component No
GO:0022857 transmembrane transporter activity No
GO:0051234 establishment of localization No
GO:0008324 cation transmembrane transporter activity No
GO:0003674 molecular_function No
GO:0006812 cation transport No
GO:0006811 ion transport No
GO:0015075 ion transmembrane transporter activity No
GO:0051179 localization No
GO:0015318 inorganic molecular entity transmembrane transporter activity No
GO:0005215 transporter activity No
GO:0110165 cellular anatomical entity No
GO:0009987 cellular process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 14 0.45

Transmembrane Domains

Domain # Start End Length
1 314 336 22
2 351 373 22
3 453 475 22
4 479 498 19
5 505 527 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 31.49 18.82 44.17
5d_25C Five days - 25 degrees Celsius 18.19 10.00 26.38
7d_25C Seven days - 25 degrees Celsius 16.58 8.89 24.28
10d_25C Ten days - 25 degrees Celsius 11.77 5.85 17.69
7d_15C Seven days - 15 degrees Celsius 15.20 8.01 22.40
7d_30C Seven days - 30 degrees Celsius 10.52 5.08 15.97

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.015833 yes
3d_25C 7d_25C 0.003197 yes
3d_25C 7d_15C 0.001278 yes
3d_25C 7d_30C 0.000700 yes
3d_25C 10d_25C 0.000700 yes
5d_25C 7d_25C 0.794710 no
5d_25C 7d_15C 0.565784 no
5d_25C 7d_30C 0.033480 yes
5d_25C 10d_25C 0.094135 no
7d_25C 7d_15C 0.812363 no
7d_25C 7d_30C 0.088767 no
7d_25C 10d_25C 0.213479 no
7d_15C 7d_30C 0.204718 no
7d_15C 10d_25C 0.404126 no
7d_30C 10d_25C 0.767219 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g8858.t1
MKQHKIQNMAGYRKRGIITLPNKSHHVIREPDMKKEVSFNQDVFNLSLALSQSRINDATELRGMVLDVDGSVKQS
EIRGTRDEIAKRWGLDGRDLRNVDLVSEGIPHLLVRPSVIFISMFTLRLLVRTNGVLLFLLPIENSHVKVQDVFM
TDLQGRLQPCPGSGLLSKLPFELRVVDAALASVIATLEAEHILIRREAEESLQDSTREDVVYSVLRGLQNHKKRL
VAIQQRARQFRSALREILENDEDMATMFLTDREAGQPHEVDDHQEVEYLLEAYYKSTDAIAESASALLGDLERTT
ETIQSILDVRRNQILVFEAQLEICMLGFAVSTFVAGLFGMNVTNFFEDSPSAFAILVGTCIIGTVTIAKVWGISK
PRRKDHPLLILNWAGYTGPTILRFPASLAKPLDRSDIAPKGPDWGLRTSIHVVAGISNLGRGLDPQRARRTFAGS
NKAVVPAIVLPLANIIMIAKLLLIFEIMYVTTVATTKISILLMYCRIFPTREIRIASLVLGGMTLSWLVAIILVS
VFQCNPIPRAWDTRIPGKCINLKGMFIGNAVPNILTDILILSLPVKVVWGLHASLTHRLVVFTSAYRFATIFGFD
PTDIAWTLGRSCTWCVVESSTGIISACMPTLRPLFMIFSSKFSSRSGTRSRTTDLDQSKGYELDNSALRPANEPR
NKTRTQLEVSHADDGSEDEVPLNSIRVQQYMTWQESRGDSFRGYK*
Coding >Pro_DTO377G3_2|g8858.t1
ATGAAACAACATAAGATCCAGAACATGGCCGGCTACCGCAAACGGGGAATCATCACGCTCCCCAATAAATCGCAT
CATGTCATCCGGGAGCCTGACATGAAAAAAGAAGTCTCCTTCAATCAGGATGTGTTCAACTTGTCTCTTGCTCTG
TCGCAAAGCCGCATAAATGATGCGACGGAGTTACGCGGCATGGTCTTGGATGTCGATGGCTCCGTCAAACAATCT
GAAATTCGAGGAACTAGAGATGAGATTGCTAAACGGTGGGGATTAGATGGTCGCGATCTACGCAACGTGGATCTT
GTCTCGGAAGGAATCCCGCATTTGTTGGTCCGTCCGTCTGTTATCTTCATCAGCATGTTTACTTTACGGCTCCTG
GTCCGCACAAATGGAGTGCTTCTATTTCTTCTCCCAATTGAAAACTCCCACGTGAAGGTGCAGGATGTCTTTATG
ACAGACCTTCAGGGCAGGCTCCAACCCTGTCCTGGCTCTGGTCTTTTATCCAAACTCCCATTTGAGCTACGAGTA
GTGGATGCGGCGCTTGCCTCTGTGATTGCGACTCTTGAAGCCGAGCATATTCTTATCCGTCGAGAAGCTGAAGAG
AGCTTGCAGGATTCAACAAGAGAAGATGTTGTTTACTCTGTTCTGCGCGGGTTGCAGAATCATAAGAAAAGGCTC
GTGGCAATTCAGCAGCGCGCCCGCCAGTTCCGCTCCGCGCTACGGGAAATTCTTGAAAATGATGAAGACATGGCG
ACCATGTTCTTAACGGATCGGGAGGCAGGTCAACCGCATGAGGTAGATGATCACCAAGAAGTGGAATACCTCCTC
GAGGCATATTACAAGAGCACGGACGCTATTGCGGAGTCTGCCAGTGCTTTACTAGGCGATTTGGAGCGCACAACG
GAGACCATTCAATCAATCTTGGATGTACGACGAAATCAGATCCTAGTTTTCGAGGCTCAACTGGAGATCTGCATG
TTGGGATTTGCCGTGTCAACTTTTGTGGCGGGCCTGTTTGGAATGAACGTGACAAACTTCTTTGAAGACAGTCCT
TCGGCATTTGCAATTCTTGTCGGAACGTGTATAATTGGAACGGTCACTATCGCGAAGGTCTGGGGAATCAGCAAA
CCCCGGCGAAAGGATCACCCTCTCCTTATACTGAACTGGGCAGGTTATACCGGGCCCACAATTCTTCGGTTCCCG
GCGTCACTAGCAAAACCGTTAGACCGGTCGGATATTGCACCAAAGGGCCCCGATTGGGGTCTTCGAACCAGTATC
CACGTGGTCGCCGGAATTTCCAATCTTGGCAGAGGCCTCGATCCACAACGGGCTAGGCGGACATTCGCAGGATCG
AACAAGGCCGTTGTTCCTGCCATTGTCTTGCCGTTAGCAAACATTATAATGATTGCAAAGCTTCTACTGATATTT
GAGATCATGTACGTCACAACGGTAGCAACCACCAAAATTTCTATCCTCCTCATGTACTGTCGCATCTTCCCCACG
AGGGAAATCCGCATCGCCTCCTTGGTATTGGGTGGGATGACACTCTCCTGGCTTGTCGCTATTATCCTCGTGAGC
GTCTTCCAATGCAATCCGATCCCGCGAGCCTGGGACACGCGCATTCCTGGTAAATGTATCAACCTTAAAGGCATG
TTCATCGGGAACGCAGTACCCAACATTCTCACCGACATTCTCATTCTGTCTCTACCGGTCAAGGTGGTGTGGGGA
CTGCACGCAAGCCTCACGCATCGACTCGTTGTCTTCACTAGTGCCTATCGCTTCGCTACCATTTTTGGATTCGAC
CCGACGGACATTGCCTGGACACTTGGAAGATCCTGCACCTGGTGTGTCGTTGAATCCTCAACGGGTATTATCTCC
GCTTGCATGCCGACCCTGCGCCCACTGTTCATGATATTTTCATCCAAGTTCTCCAGCCGGTCTGGGACTAGATCA
CGAACTACAGATCTCGACCAATCTAAAGGTTATGAGTTGGATAACTCTGCCCTACGACCGGCGAATGAGCCGCGT
AATAAAACCAGAACACAGCTGGAGGTGTCCCATGCCGACGATGGGTCTGAGGATGAGGTGCCATTGAATTCCATC
CGAGTTCAGCAGTATATGACATGGCAAGAATCCAGGGGTGACTCTTTTCGAGGATATAAATAA
Transcript >Pro_DTO377G3_2|g8858.t1
ATGAAACAACATAAGATCCAGAACATGGCCGGCTACCGCAAACGGGGAATCATCACGCTCCCCAATAAATCGCAT
CATGTCATCCGGGAGCCTGACATGAAAAAAGAAGTCTCCTTCAATCAGGATGTGTTCAACTTGTCTCTTGCTCTG
TCGCAAAGCCGCATAAATGATGCGACGGAGTTACGCGGCATGGTCTTGGATGTCGATGGCTCCGTCAAACAATCT
GAAATTCGAGGAACTAGAGATGAGATTGCTAAACGGTGGGGATTAGATGGTCGCGATCTACGCAACGTGGATCTT
GTCTCGGAAGGAATCCCGCATTTGTTGGTCCGTCCGTCTGTTATCTTCATCAGCATGTTTACTTTACGGCTCCTG
GTCCGCACAAATGGAGTGCTTCTATTTCTTCTCCCAATTGAAAACTCCCACGTGAAGGTGCAGGATGTCTTTATG
ACAGACCTTCAGGGCAGGCTCCAACCCTGTCCTGGCTCTGGTCTTTTATCCAAACTCCCATTTGAGCTACGAGTA
GTGGATGCGGCGCTTGCCTCTGTGATTGCGACTCTTGAAGCCGAGCATATTCTTATCCGTCGAGAAGCTGAAGAG
AGCTTGCAGGATTCAACAAGAGAAGATGTTGTTTACTCTGTTCTGCGCGGGTTGCAGAATCATAAGAAAAGGCTC
GTGGCAATTCAGCAGCGCGCCCGCCAGTTCCGCTCCGCGCTACGGGAAATTCTTGAAAATGATGAAGACATGGCG
ACCATGTTCTTAACGGATCGGGAGGCAGGTCAACCGCATGAGGTAGATGATCACCAAGAAGTGGAATACCTCCTC
GAGGCATATTACAAGAGCACGGACGCTATTGCGGAGTCTGCCAGTGCTTTACTAGGCGATTTGGAGCGCACAACG
GAGACCATTCAATCAATCTTGGATGTACGACGAAATCAGATCCTAGTTTTCGAGGCTCAACTGGAGATCTGCATG
TTGGGATTTGCCGTGTCAACTTTTGTGGCGGGCCTGTTTGGAATGAACGTGACAAACTTCTTTGAAGACAGTCCT
TCGGCATTTGCAATTCTTGTCGGAACGTGTATAATTGGAACGGTCACTATCGCGAAGGTCTGGGGAATCAGCAAA
CCCCGGCGAAAGGATCACCCTCTCCTTATACTGAACTGGGCAGGTTATACCGGGCCCACAATTCTTCGGTTCCCG
GCGTCACTAGCAAAACCGTTAGACCGGTCGGATATTGCACCAAAGGGCCCCGATTGGGGTCTTCGAACCAGTATC
CACGTGGTCGCCGGAATTTCCAATCTTGGCAGAGGCCTCGATCCACAACGGGCTAGGCGGACATTCGCAGGATCG
AACAAGGCCGTTGTTCCTGCCATTGTCTTGCCGTTAGCAAACATTATAATGATTGCAAAGCTTCTACTGATATTT
GAGATCATGTACGTCACAACGGTAGCAACCACCAAAATTTCTATCCTCCTCATGTACTGTCGCATCTTCCCCACG
AGGGAAATCCGCATCGCCTCCTTGGTATTGGGTGGGATGACACTCTCCTGGCTTGTCGCTATTATCCTCGTGAGC
GTCTTCCAATGCAATCCGATCCCGCGAGCCTGGGACACGCGCATTCCTGGTAAATGTATCAACCTTAAAGGCATG
TTCATCGGGAACGCAGTACCCAACATTCTCACCGACATTCTCATTCTGTCTCTACCGGTCAAGGTGGTGTGGGGA
CTGCACGCAAGCCTCACGCATCGACTCGTTGTCTTCACTAGTGCCTATCGCTTCGCTACCATTTTTGGATTCGAC
CCGACGGACATTGCCTGGACACTTGGAAGATCCTGCACCTGGTGTGTCGTTGAATCCTCAACGGGTATTATCTCC
GCTTGCATGCCGACCCTGCGCCCACTGTTCATGATATTTTCATCCAAGTTCTCCAGCCGGTCTGGGACTAGATCA
CGAACTACAGATCTCGACCAATCTAAAGGTTATGAGTTGGATAACTCTGCCCTACGACCGGCGAATGAGCCGCGT
AATAAAACCAGAACACAGCTGGAGGTGTCCCATGCCGACGATGGGTCTGAGGATGAGGTGCCATTGAATTCCATC
CGAGTTCAGCAGTATATGACATGGCAAGAATCCAGGGGTGACTCTTTTCGAGGATATAAATAA
Gene >Pro_DTO377G3_2|g8858.t1
ATGAAACAACATAAGATCCAGAACATGGCCGGCTACCGCAAACGGGGAATCATCACGCTCCCCAATAAATCGCAT
CATGTCATCCGGGAGCCTGACATGAAAAAAGAAGTCTCCTTCAATCAGGATGTGTTCAACTTGTCTCTTGCTCTG
TCGCAAAGCCGCATAAATGATGCGACGGAGTTACGCGGCATGGTCTTGGATGTCGATGGCTCCGTCAAACAATCT
GAAATTCGAGGAACTAGAGATGAGATTGCTAAACGGTGGGGATTAGATGGTCGCGATCTACGCAACGTGGATCTT
GTCTCGGAAGGAATCCCGCATTTGTTGGTCCGTCCGTCTGTTATCTTCATCAGCATGTTTACTTTACGGCTCCTG
GTCCGCACAAATGGAGTGCTTCTATTTCTTCTCCCAATTGAAAACTCCCACGTGAAGGTGCAGGATGTCTTTATG
ACAGACCTTCAGGGCAGGCTCCAACCCTGTCCTGGCTCTGGTCTTTTATCCAAACTCCCATTTGAGCTACGAGTA
GTGGATGCGGCGCTTGCCTCTGTGATTGCGACTCTTGAAGCCGAGCATATTCTTATCCGTCGAGAAGCTGAAGAG
AGCTTGCAGGATTCAACAAGAGAAGATGTTGTTTACTCTGTTCTGCGCGGGTTGCAGAATCATAAGAAAAGGCTC
GTGGCAATTCAGCAGCGCGCCCGCCAGTTCCGCTCCGCGCTACGGGAAATTCTTGAAAATGATGAAGACATGGCG
ACCATGTTCTTAACGGATCGGGAGGCAGGTCAACCGCATGAGGTAGATGATCACCAAGAAGTGGAATACCTCCTC
GAGGCATATTACAAGAGCACGGACGCTATTGCGGAGTCTGCCAGTGCTTTACTAGGCGATTTGGAGCGCACAACG
GAGACCATTCAATCAATCTTGGATGTACGACGAAATCAGATCCTAGTTTTCGAGGCTCAACTGGAGATCTGCATG
TTGGGATTTGCCGTGTCAACTTTTGTGGCGGGCCTGTTTGGAATGAACGTGACAAACTTCTTTGAAGACAGTCCT
TCGGCATTTGCAATTCTTGTCGGAACGTGTATAATTGGAACGGTCACTATCGCGAAGTATGGGCTATGGAAACTC
AATAAATTCCGGACATTGCGTTTTTAGAGCGAGCTTGCATATTCATCATTGGAAAAATCAAATGAAGTCTTTTTC
TGTAGGCGAGGATGCACGGGGATTTAAATTGGCAGTGCCATTTCTTGTATGAAGTAGAAATATAAAAACGAGAGA
TGCGACTTGACCTAATCATGATAGGTTGACGGACTACAAAAGCAGCAGGGAAGTTATATATATCAAGTCGTGTGC
TTGCAAGTTAGAGGTGAACCCTTTTACCAGATGAGTAGAGGCATATATATATCTATAGAGCAAAGCGGGTAATAA
ATTAAAGATTCACAACATTTGATCTTCAAGAACCGAAAACACTCCAAATCGACTCTCACTGACACTCAGAGCATA
CGGCTCCGCGGGATTGAACTTCAACTATTACCATTACTCCCACCAGTAAGTGATACCTCATATCTCTATTTAGTG
GTTACCCCGTCTGGTGTCTGCATTTGACTGACAAGTATTTTTACAAATTAGTGATGATTCCTACGACTACTCAAC
CTCCATGGCAGCACGCACTACAACGGCAGCAAGGGCGATGCTGTGTACACCCCTCCCCCTGCGCCTGGATGACCA
TCCAGGAAAGGAGGCTTCCGCCCAGCATGTCCTTTACCGTTTTCCCCTGGGACGTCACAAATGCAGCCATGATTA
CGCCGGGAAGACCGGCTTTGCACCGCTGCGTGTACCCAGGCCCCCAACAACCCCGGCGCCGACGATTTCGCCACA
GGAGTCGTTTACCACCAAAATCTAGCAGCCAGCTTCTACCATTTCTTTGAGAGACGTTAATTGTGATGCGCCCAC
AGACGGGCCGAAATAAGTCCGCGCTTGTGCGTTTAGATCTAGAAGGACGTCGACTGTGTCAGCGGCCTGTCATGC
GCCTAGTGCGAAGACGAAAACGGGTTCTCAAACATGGCCATCGTGTAATTGGGGTGGGAAAACACTCCGTACATC
TACGCCCAACCAGGGTCTGGGGAATCAGCAAACCCCGGCGAAAGGATCACCCTCTCCTTATACTGAACTGGGCAG
GTTATACCGGGCCCACAATTCTTCGGTACGTGGAACGATTGGCTCTTTGGATCTATTGTTATAATCAATTTCCTT
GAAGTATTCCGACTGCTTGGGCCAACGATGGAGCCCGACTGAGATTCACCTTGTTATAGGTTCCCGGCGTCACTA
GCAAAACCGTTAGACCGGTCGGATATTGCACCAAAGGGCCCCGATTGGGGTCTTCGAACCAGTATCCACGTGGTC
GCCGGAATTTCCAATCTTGGCAGAGGCCTCGATCCACAACGGGCTAGGCGGACATTCGCAGGATCGAACAAGGCC
GTTGTTCCTGCCATTGTTCTTATTTACGGAGCATACCCTTTTCTGTTCGTTGTTCTCGTGCTTCTGATTTGCTGT
GGGATATTGACATGCAGATCATCAGGGATATGCAGAATACCCGGAGTTCCCAGCGGATATCTTTTCCTGTGCTAC
TCCGTACAACATTGTAAAACAGTATTCTCTCCTATCAACTTGTATTTTATTCAGCAACAGCGCAAAGTCGAAAGG
AACTGGTGTCCAAGTGTTACATATGATAACAAGTACCAGCAGACCCAAAGCCTAATGTACTAAACCCTGTATCTA
GTCAGGGCCGACTGAACCTTAAACCTATACGAAGGAAATAATGAAAATCATACGACTGGAGGAATAACATGATCC
CCTCGTCTCAAAATGTTACGCACCAAAGCACATCGAATTTTGTTGCGGTGGCATTCCGTAGTATTCCGCAGTCCT
CTTACTAGTTGCAACACAGAGAGTATTAAAATACGGATTGATCCTCGCAATATTAATCGTGCACACATTAGGCAT
ACCGTTTGTCGCTCAATAGTGGATAACCATGAATCCTGACACTTGAAGTGGATCATCTCTGACAAGTCTCTTTTG
CCGCTTCGGGGGCTGCATGAGAGGAATCAATTCTCTTTAAAGTAAGCATTGCCGCACCTTGATCTTGGCCTGTTT
CGAACGTCCCAACACGATGGCTGCATACAATGCCCAGGATAGCTACCAAGGGTCCTATCGGGCCGGGACGATCAC
GATGACTGTCCTGGGCGTCTTGTTTGTGATTTTACGGTTTCTCGCACGGTGGAAGAAATCACTAAAGCCAGGCCT
GGACGACTTTTTTATCGTGCTCGCTCTCTTTCCTTTGTTAGCACTCGTTGGATTGATGCTATCTTGTACGACACA
TTTCCCCTAAAGGTTGTTGATTCTCATGCTAATTGTTGATAGTAACTAATTATGGCATGGGTTTACATTCTCAGG
TCTTGCCGTTAGCAAACATTATAATGATTGCAAAGGTCCGATTCAAATTACAGAGGATACAGTTGATACCTCCGC
TAACATCCAAGTAGCTTCTACTGATATTTGAGATCATGTACGTCACAACGGTAGCAACCACCAAAATTTCTATCC
TCCTCATGTACTGTCGCATCTTCCCCACGAGGGAAATCCGCATCGCCTCCTTGGTATTGGGTGGGATGACACTCT
CCTGGCTTGTCGCTATTATCCTCGTGAGCGTCTTCCAATGCAATCCGATCCCGCGAGCCTGGGACACGCGCATTC
CTGGTAAATGTATCAACCTTAAAGGCATGTTCATCGGGAACGCAGTACCCAACATTCTCACCGACATTCTCATTC
TGTCTCTACCGGTCAAGGTGGTGTGGGGACTGCACGCAAGCCTCACGCATCGACTGTCCGTGGTTGGAATATTTC
TCTTGGGTAGTTTGTCCGTATATCCATTTCCTACATATTACTACTTTGTGACGATAGACTAACCGGGCTGCTCTC
CCTTAGCGTTGTCTTCACTAGTGCCTATCGCTTCGCTACCATTTTTGGATTCGACCCGACGGACATTGCCTGGAC
ACTTGGAAGATCCTGCACCTGGTGTGTCGTTGAATCCTCAACGGGTATTATCTCCGCTTGCATGCCGACCCTGCG
CCCACTGTTCATGATATTTTCATCCAAGTTCTCCAGCCGGTCTGGGACTAGATCACGAACTACAGATCTCGACCA
ATCTAAAGGTTATGAGTTGGATAACTCTGCCCTACGACCGGCGAATGAGCCGCGTAATAAAACCAGAACACAGCT
GGAGGTGTCCCATGCCGACGATGGGTCTGAGGATGAGGTGCCATTGAATTCCATCCGAGTTCAGCAGTATATGAC
ATGGCAAGAATCCAGGGGTGACTCTTTTCGAGGATATAAATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail