Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g8832.t1
Gene name
Locationscaffold_37:183239..184004
Strand+
Gene length (bp)765
Transcript length (bp)765
Coding sequence length (bp)765
Protein length (aa) 255

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00642 zf-CCCH Zinc finger C-x8-C-x5-C-x3-H type (and similar) 1.9E-05 117 140

GO

GO Term Description Terminal node
GO:0046872 metal ion binding Yes
GO:0005488 binding No
GO:0043167 ion binding No
GO:0043169 cation binding No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 50 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 65.62 35.97 95.27
5d_25C Five days - 25 degrees Celsius 77.78 44.12 111.44
7d_25C Seven days - 25 degrees Celsius 77.11 43.37 110.85
10d_25C Ten days - 25 degrees Celsius 119.65 71.35 167.95
7d_15C Seven days - 15 degrees Celsius 82.24 47.02 117.46
7d_30C Seven days - 30 degrees Celsius 78.90 44.51 113.30

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.561515 no
3d_25C 7d_25C 0.599120 no
3d_25C 7d_15C 0.415539 no
3d_25C 7d_30C 0.530648 no
3d_25C 10d_25C 0.006371 yes
5d_25C 7d_25C 0.982845 no
5d_25C 7d_15C 0.874776 no
5d_25C 7d_30C 0.970933 no
5d_25C 10d_25C 0.053152 no
7d_25C 7d_15C 0.856182 no
7d_25C 7d_30C 0.953097 no
7d_25C 10d_25C 0.054593 no
7d_15C 7d_30C 0.908439 no
7d_15C 10d_25C 0.104626 no
7d_30C 10d_25C 0.073301 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g8832.t1
MAAETESAAAQILSAEPTRDPSYNDFSFTPFLRKSFGFGLASDVPVCKAYSEGHCPLGPACPDRHPTPSRVTTST
TTASGMAPSTTHGSLVCKHFLKGLCKKGLKCEYLHEYNLRRMPECQSFSRSGYCTNGDDCLYQHVREEARLPPCE
HYDRGYCELGPLCAKRHVRRRLCTFYLAGFCPDGKACADAHPRWPENLPRPTMRTEKTEEELEHERVLIREEQER
EKEREREWRNERGRGGGFGRGRFRGRGRG*
Coding >Pro_DTO377G3_2|g8832.t1
ATGGCTGCCGAAACTGAAAGTGCAGCTGCGCAAATCCTATCCGCCGAGCCGACGCGCGATCCCAGCTACAATGAC
TTTTCTTTCACACCCTTTCTGCGCAAGAGCTTCGGCTTCGGACTCGCCAGCGATGTACCTGTTTGCAAAGCCTAT
AGTGAAGGACACTGTCCATTAGGGCCTGCCTGTCCAGATCGGCATCCCACTCCGTCCCGTGTGACAACCTCGACT
ACCACAGCCTCCGGAATGGCGCCATCTACAACACACGGATCGCTGGTTTGCAAACATTTCCTCAAGGGACTCTGT
AAGAAAGGACTGAAATGCGAATACCTCCACGAATATAACCTCCGACGAATGCCAGAATGCCAGTCATTTTCTCGA
TCTGGATACTGTACCAATGGTGACGATTGCCTTTATCAGCATGTTCGAGAGGAGGCACGACTGCCGCCTTGCGAA
CACTACGACCGTGGATATTGCGAATTGGGACCATTATGTGCAAAGCGACACGTCCGCCGACGTCTATGTACATTC
TATCTGGCCGGGTTCTGCCCTGATGGGAAAGCGTGTGCCGATGCCCACCCTCGCTGGCCGGAAAATCTACCACGG
CCTACAATGCGTACTGAAAAGACAGAGGAAGAACTTGAGCATGAACGAGTTCTCATCCGTGAAGAACAAGAACGC
GAAAAAGAACGGGAACGAGAATGGCGAAATGAACGTGGTCGGGGCGGTGGATTTGGGCGTGGCCGCTTCCGCGGG
CGTGGAAGAGGTTAG
Transcript >Pro_DTO377G3_2|g8832.t1
ATGGCTGCCGAAACTGAAAGTGCAGCTGCGCAAATCCTATCCGCCGAGCCGACGCGCGATCCCAGCTACAATGAC
TTTTCTTTCACACCCTTTCTGCGCAAGAGCTTCGGCTTCGGACTCGCCAGCGATGTACCTGTTTGCAAAGCCTAT
AGTGAAGGACACTGTCCATTAGGGCCTGCCTGTCCAGATCGGCATCCCACTCCGTCCCGTGTGACAACCTCGACT
ACCACAGCCTCCGGAATGGCGCCATCTACAACACACGGATCGCTGGTTTGCAAACATTTCCTCAAGGGACTCTGT
AAGAAAGGACTGAAATGCGAATACCTCCACGAATATAACCTCCGACGAATGCCAGAATGCCAGTCATTTTCTCGA
TCTGGATACTGTACCAATGGTGACGATTGCCTTTATCAGCATGTTCGAGAGGAGGCACGACTGCCGCCTTGCGAA
CACTACGACCGTGGATATTGCGAATTGGGACCATTATGTGCAAAGCGACACGTCCGCCGACGTCTATGTACATTC
TATCTGGCCGGGTTCTGCCCTGATGGGAAAGCGTGTGCCGATGCCCACCCTCGCTGGCCGGAAAATCTACCACGG
CCTACAATGCGTACTGAAAAGACAGAGGAAGAACTTGAGCATGAACGAGTTCTCATCCGTGAAGAACAAGAACGC
GAAAAAGAACGGGAACGAGAATGGCGAAATGAACGTGGTCGGGGCGGTGGATTTGGGCGTGGCCGCTTCCGCGGG
CGTGGAAGAGGTTAG
Gene >Pro_DTO377G3_2|g8832.t1
ATGGCTGCCGAAACTGAAAGTGCAGCTGCGCAAATCCTATCCGCCGAGCCGACGCGCGATCCCAGCTACAATGAC
TTTTCTTTCACACCCTTTCTGCGCAAGAGCTTCGGCTTCGGACTCGCCAGCGATGTACCTGTTTGCAAAGCCTAT
AGTGAAGGACACTGTCCATTAGGGCCTGCCTGTCCAGATCGGCATCCCACTCCGTCCCGTGTGACAACCTCGACT
ACCACAGCCTCCGGAATGGCGCCATCTACAACACACGGATCGCTGGTTTGCAAACATTTCCTCAAGGGACTCTGT
AAGAAAGGACTGAAATGCGAATACCTCCACGAATATAACCTCCGACGAATGCCAGAATGCCAGTCATTTTCTCGA
TCTGGATACTGTACCAATGGTGACGATTGCCTTTATCAGCATGTTCGAGAGGAGGCACGACTGCCGCCTTGCGAA
CACTACGACCGTGGATATTGCGAATTGGGACCATTATGTGCAAAGCGACACGTCCGCCGACGTCTATGTACATTC
TATCTGGCCGGGTTCTGCCCTGATGGGAAAGCGTGTGCCGATGCCCACCCTCGCTGGCCGGAAAATCTACCACGG
CCTACAATGCGTACTGAAAAGACAGAGGAAGAACTTGAGCATGAACGAGTTCTCATCCGTGAAGAACAAGAACGC
GAAAAAGAACGGGAACGAGAATGGCGAAATGAACGTGGTCGGGGCGGTGGATTTGGGCGTGGCCGCTTCCGCGGG
CGTGGAAGAGGTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail