Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g8829.t1
Gene name
Locationscaffold_37:174473..176644
Strand-
Gene length (bp)2171
Transcript length (bp)2049
Coding sequence length (bp)2049
Protein length (aa) 683

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00501 AMP-binding AMP-binding enzyme 6.8E-42 114 488
PF13193 AMP-binding_C AMP-binding enzyme C-terminal domain 3.8E-05 570 634

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 14 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g8829.t1
MASPTKSESSDALRPRPIWEPTIPQDQIPMNIYRAHINKKFNQQLRSSHDLHQWSVENLQDFWTDLHGYTGIIPP
LPPTVTSAFDPSTPMDKVPKFFHGATVNYAENVVSGRDLDKTALVGVREGHDLSGEVWTWGVLRENVRKARSALL
KLGVKEQDRVAAVISNSVWSVGLFLATASIGAIWTSIAPDLGEEGCVSRLQQVTPRVLFADAESTYKGKMRSNVV
KIKSIVKALHSKPQVFLIPIIGAHESAFPSLDRFLSMSRREDRLGFKRVSFSHPLYILYTSGTTGQPKCLVHSHG
VILQHKKTSVLHNSLTSEDVVFQYSSTSWVLWNVMVGHLSVGPTLILYDGSPLWPSAKGLAKIAGYHKVSYWGCS
PRYLQELEMTGCIPKNEFDLSSLRMVQTGGSHLGEDQYHWFYRTFPSSVHLTSVTGATDLATSWIGTDPAGPLYP
GEIQLPMLGHDLDIAHPLTGASIKNTGRHGEFVCRKPFPSMPVFFWGDEDGSKYKSAYFEKFENCWAQHDWASYN
PQTKGWQIHGRSDGVLNPQGIRFGSSDIYSITESAPFNSVISTTFCVGRRRSHDSDEVVFLFVVMQSGKPFTGQL
AVELKDAIRKGLSSKHVPRFVIEVKEVPMTVNGKKVETLIKQVISSGQLPKIISSTVANPRSLDHFRQYYDLEVQ
NNNRSKL*
Coding >Pro_DTO377G3_2|g8829.t1
ATGGCAAGCCCTACGAAGAGCGAGTCGAGCGACGCTCTCAGGCCTCGTCCCATCTGGGAACCTACCATCCCGCAA
GACCAAATACCCATGAATATCTATCGTGCGCATATCAACAAGAAGTTCAATCAGCAGCTTCGCTCTTCTCATGAT
CTGCATCAATGGTCCGTTGAGAATCTGCAAGATTTCTGGACAGACCTCCATGGCTATACGGGAATTATTCCACCA
TTGCCTCCGACAGTAACATCCGCATTTGATCCTAGCACGCCAATGGACAAGGTACCCAAATTCTTCCACGGAGCA
ACTGTCAACTATGCGGAGAATGTTGTGTCTGGTCGGGACTTGGACAAGACGGCTCTTGTTGGAGTTCGAGAGGGC
CATGATCTGAGTGGGGAGGTGTGGACATGGGGAGTGTTGAGGGAGAATGTCAGAAAGGCAAGGAGTGCTTTGCTC
AAGCTCGGTGTTAAAGAACAAGATAGGGTTGCTGCTGTCATCTCGAATAGCGTCTGGTCGGTCGGTTTGTTCCTG
GCGACTGCGAGTATCGGCGCGATTTGGACTAGTATTGCACCGGATTTGGGTGAAGAGGGCTGTGTGTCACGGTTA
CAACAAGTCACTCCACGGGTTCTCTTCGCAGATGCCGAATCCACATATAAGGGGAAAATGCGATCGAACGTCGTC
AAGATCAAAAGCATCGTGAAGGCATTGCACTCAAAGCCACAGGTGTTTTTGATTCCTATCATCGGCGCCCATGAG
TCGGCATTCCCCAGTCTCGATCGCTTCTTGTCAATGTCACGGCGAGAGGACAGGCTAGGGTTCAAAAGAGTGTCC
TTCTCTCATCCACTCTATATCCTATACACCAGCGGCACCACCGGTCAGCCAAAGTGCCTGGTGCACAGCCATGGC
GTTATTTTGCAGCACAAGAAGACATCCGTACTGCACAACTCTTTGACATCCGAGGATGTTGTTTTCCAGTATAGT
AGTACCTCATGGGTCTTGTGGAATGTCATGGTCGGTCACCTCTCCGTAGGTCCGACTCTGATTCTGTACGACGGA
TCTCCGTTATGGCCCAGTGCCAAAGGACTGGCAAAGATTGCGGGGTACCATAAGGTCTCATACTGGGGTTGCTCC
CCTCGCTATCTACAGGAGCTCGAGATGACCGGTTGTATCCCAAAGAACGAATTCGATCTATCCTCCCTCAGAATG
GTGCAGACAGGTGGCTCTCATCTGGGTGAAGACCAATACCACTGGTTCTACCGCACATTCCCTTCCAGTGTTCAT
CTCACCAGTGTAACAGGCGCCACGGACTTGGCGACTTCTTGGATTGGAACTGACCCTGCAGGTCCACTGTATCCT
GGGGAGATCCAGCTTCCTATGCTTGGGCACGACTTGGACATTGCTCATCCTCTCACGGGAGCTTCTATCAAGAAC
ACTGGAAGACATGGCGAGTTCGTCTGTCGCAAACCATTTCCATCAATGCCAGTCTTTTTCTGGGGCGATGAAGAT
GGATCGAAATACAAGAGCGCCTATTTCGAGAAATTTGAGAATTGTTGGGCTCAACACGATTGGGCGAGTTATAAC
CCGCAAACAAAAGGTTGGCAGATTCATGGAAGGAGCGATGGTGTCCTTAATCCACAGGGTATTCGTTTTGGGTCT
TCAGATATATACTCGATCACCGAATCAGCTCCTTTCAACTCGGTCATTTCAACCACTTTCTGTGTCGGGCGTCGA
CGATCTCACGACTCTGATGAAGTTGTGTTTTTGTTTGTCGTGATGCAGTCTGGAAAGCCGTTCACGGGCCAACTT
GCTGTAGAGCTCAAGGATGCAATTCGCAAAGGCTTGAGCAGTAAGCATGTTCCTCGCTTCGTGATCGAGGTCAAA
GAAGTCCCTATGACGGTCAATGGTAAAAAGGTGGAGACATTGATAAAGCAGGTCATTTCATCTGGCCAGCTTCCT
AAGATTATTAGCAGCACCGTTGCGAATCCTAGGTCTCTAGATCACTTCAGGCAGTATTATGATCTTGAGGTCCAA
AACAACAACAGAAGCAAGCTATAG
Transcript >Pro_DTO377G3_2|g8829.t1
ATGGCAAGCCCTACGAAGAGCGAGTCGAGCGACGCTCTCAGGCCTCGTCCCATCTGGGAACCTACCATCCCGCAA
GACCAAATACCCATGAATATCTATCGTGCGCATATCAACAAGAAGTTCAATCAGCAGCTTCGCTCTTCTCATGAT
CTGCATCAATGGTCCGTTGAGAATCTGCAAGATTTCTGGACAGACCTCCATGGCTATACGGGAATTATTCCACCA
TTGCCTCCGACAGTAACATCCGCATTTGATCCTAGCACGCCAATGGACAAGGTACCCAAATTCTTCCACGGAGCA
ACTGTCAACTATGCGGAGAATGTTGTGTCTGGTCGGGACTTGGACAAGACGGCTCTTGTTGGAGTTCGAGAGGGC
CATGATCTGAGTGGGGAGGTGTGGACATGGGGAGTGTTGAGGGAGAATGTCAGAAAGGCAAGGAGTGCTTTGCTC
AAGCTCGGTGTTAAAGAACAAGATAGGGTTGCTGCTGTCATCTCGAATAGCGTCTGGTCGGTCGGTTTGTTCCTG
GCGACTGCGAGTATCGGCGCGATTTGGACTAGTATTGCACCGGATTTGGGTGAAGAGGGCTGTGTGTCACGGTTA
CAACAAGTCACTCCACGGGTTCTCTTCGCAGATGCCGAATCCACATATAAGGGGAAAATGCGATCGAACGTCGTC
AAGATCAAAAGCATCGTGAAGGCATTGCACTCAAAGCCACAGGTGTTTTTGATTCCTATCATCGGCGCCCATGAG
TCGGCATTCCCCAGTCTCGATCGCTTCTTGTCAATGTCACGGCGAGAGGACAGGCTAGGGTTCAAAAGAGTGTCC
TTCTCTCATCCACTCTATATCCTATACACCAGCGGCACCACCGGTCAGCCAAAGTGCCTGGTGCACAGCCATGGC
GTTATTTTGCAGCACAAGAAGACATCCGTACTGCACAACTCTTTGACATCCGAGGATGTTGTTTTCCAGTATAGT
AGTACCTCATGGGTCTTGTGGAATGTCATGGTCGGTCACCTCTCCGTAGGTCCGACTCTGATTCTGTACGACGGA
TCTCCGTTATGGCCCAGTGCCAAAGGACTGGCAAAGATTGCGGGGTACCATAAGGTCTCATACTGGGGTTGCTCC
CCTCGCTATCTACAGGAGCTCGAGATGACCGGTTGTATCCCAAAGAACGAATTCGATCTATCCTCCCTCAGAATG
GTGCAGACAGGTGGCTCTCATCTGGGTGAAGACCAATACCACTGGTTCTACCGCACATTCCCTTCCAGTGTTCAT
CTCACCAGTGTAACAGGCGCCACGGACTTGGCGACTTCTTGGATTGGAACTGACCCTGCAGGTCCACTGTATCCT
GGGGAGATCCAGCTTCCTATGCTTGGGCACGACTTGGACATTGCTCATCCTCTCACGGGAGCTTCTATCAAGAAC
ACTGGAAGACATGGCGAGTTCGTCTGTCGCAAACCATTTCCATCAATGCCAGTCTTTTTCTGGGGCGATGAAGAT
GGATCGAAATACAAGAGCGCCTATTTCGAGAAATTTGAGAATTGTTGGGCTCAACACGATTGGGCGAGTTATAAC
CCGCAAACAAAAGGTTGGCAGATTCATGGAAGGAGCGATGGTGTCCTTAATCCACAGGGTATTCGTTTTGGGTCT
TCAGATATATACTCGATCACCGAATCAGCTCCTTTCAACTCGGTCATTTCAACCACTTTCTGTGTCGGGCGTCGA
CGATCTCACGACTCTGATGAAGTTGTGTTTTTGTTTGTCGTGATGCAGTCTGGAAAGCCGTTCACGGGCCAACTT
GCTGTAGAGCTCAAGGATGCAATTCGCAAAGGCTTGAGCAGTAAGCATGTTCCTCGCTTCGTGATCGAGGTCAAA
GAAGTCCCTATGACGGTCAATGGTAAAAAGGTGGAGACATTGATAAAGCAGGTCATTTCATCTGGCCAGCTTCCT
AAGATTATTAGCAGCACCGTTGCGAATCCTAGGTCTCTAGATCACTTCAGGCAGTATTATGATCTTGAGGTCCAA
AACAACAACAGAAGCAAGCTATAG
Gene >Pro_DTO377G3_2|g8829.t1
ATGGCAAGCCCTACGAAGAGCGAGTCGAGCGACGCTCTCAGGCCTCGTCCCATCTGGGAACCTACCATCCCGCAA
GACCAAATACCCATGAATATCTATCGTGCGCATATCAACAAGAAGTTCAATCAGCAGCTTCGCTCTTCTCATGAT
CTGCATCAATGGTCCGTTGAGAATCTGCAAGATTTCTGGACAGACCTCCATGGCTATACGGGAATTATTCCACCA
TTGCCTCCGACAGTAACATCCGCATTTGATCCTAGCACGCCAATGGACAAGGTACCCAAATTCTTCCACGGAGCA
ACTGTCAACTATGCGGAGAATGTTGTGTCTGGTCGGGACTTGGACAAGACGGCTCTTGTTGGAGTTCGAGAGGGC
CATGATCTGAGTGGGGAGGTGTGGACATGGGGAGTGTTGAGGGAGAATGTCAGAAAGGCAAGGAGTGCTTTGCTC
AAGCTCGGTGTTAAAGAACAAGATAGGGTTGCTGCTGTCATCTCGAATAGCGTCTGGTCGGTCGGTTTGTTCCTG
GCGACTGCGAGTATCGGCGCGATTTGGACTAGTATTGCACCGGATTTGGGTGAAGAGGTATGTCTCGCAGGAATG
GGAATTGCTGTCGACATCGGAGACTGATTAGAAATACTAGGGCTGTGTGTCACGGTTACAACAAGTCACTCCACG
GGTTCTCTTCGCAGATGCCGAATCCACATATAAGGGGAAAATGCGATCGAACGTCGTCAAGATCAAAAGCATCGT
GAAGGCATTGCACTCAAAGCCACAGGTGTTTTTGATTCCTATCATCGGCGCCCATGAGTCGGCATTCCCCAGTCT
CGATCGCTTCTTGTCAATGTCACGGCGAGAGGACAGGCTAGGGTTCAAAAGAGTGTCCTTCTCTCATCCACTCTA
TATCCTATACACCAGCGGCACCACCGGTCAGCCAAAGTGCCTGGTGCACAGCCATGGCGTTATTTTGCAGCACAA
GAAGACATCCGTACTGCACAACTCTTTGACATCCGAGGATGTTGTTTTCCAGTATAGTAGTACCTCATGGGTCTT
GTGGAATGTCATGGTCGGTCACCTCTCCGTAGGTCCGACTCTGATTCTGTACGACGGATCTCCGTTATGGCCCAG
TGCCAAAGGACTGGCAAAGATTGCGGGGTACCATAAGGTCTCATACTGGGGTTGCTCCCCTCGCTATCTACAGGA
GCTCGAGATGACCGGTTGTATCCCAAAGAACGAATTCGATCTATCCTCCCTCAGAATGGTGCAGACAGGTGGCTC
TCATCTGGGTGAAGACCAATACCACTGGTTCTACCGCACATTCCCTTCCAGTGTTCATCTCACCAGTGTAACAGG
CGCCACGGACTTGGCGACTTCTTGGATTGGAACTGACCCTGCAGGTCCACTGTATCCTGGGGAGATCCAGCTTCC
TATGCTTGGGCACGACTTGGACATTGCTCATCCTCTCACGGGAGCTTCTATCAAGAACACTGGAAGACATGGCGA
GTTCGTCTGTCGCAAACCATTTCCATCAATGCCAGTCTTTTTCTGGGGCGATGAAGATGGATCGAAATACAAGAG
CGCCTATTTCGAGAAATTTGAGAATTGTTGGGCTCAACACGATTGGGCGAGTTATAACCCGCAAACAAAAGGTTG
GCAGATTCATGGAAGGAGGTACGTTTTATTTCTCTGTCGGAATAAATTTGGGGAAAGTGCGTGCTGACTGGGAAA
CCGACAGCGATGGTGTCCTTAATCCACAGGGTATTCGTTTTGGGTCTTCAGATATATACTCGATCACCGAATCAG
CTCCTTTCAACTCGGTCATTTCAACCACTTTCTGTGTCGGGCGTCGACGATCTCACGACTCTGATGAAGTTGTGT
TTTTGTTTGTCGTGATGCAGTCTGGAAAGCCGTTCACGGGCCAACTTGCTGTAGAGCTCAAGGATGCAATTCGCA
AAGGCTTGAGCAGTAAGCATGTTCCTCGCTTCGTGATCGAGGTCAAAGAAGTCCCTATGACGGTCAATGGTAAAA
AGGTGGAGACATTGATAAAGCAGGTCATTTCATCTGGCCAGCTTCCTAAGATTATTAGCAGCACCGTTGCGAATC
CTAGGTCTCTAGATCACTTCAGGCAGTATTATGATCTTGAGGTCCAAAACAACAACAGAAGCAAGCTATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail